KEGG   Streptococcus equi subsp. zooepidemicus MGCS10565: Sez_0881Help
Entry
Sez_0881          CDS       T00746                                 

Gene name
pfkA
Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
sez  Streptococcus equi subsp. zooepidemicus MGCS10565
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:sez00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Sez_0881 (pfkA)
   01230 Biosynthesis of amino acids
    Sez_0881 (pfkA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Sez_0881 (pfkA)
   00030 Pentose phosphate pathway
    Sez_0881 (pfkA)
   00051 Fructose and mannose metabolism
    Sez_0881 (pfkA)
   00052 Galactose metabolism
    Sez_0881 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    Sez_0881 (pfkA)
Enzymes [BR:sez01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Sez_0881 (pfkA)
Protein phosphatases and associated proteins [BR:sez01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Sez_0881 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
924470..925483
Genome map
AA seq 337 aa AA seqDB search
MKRIAVLTSGGDAPGMNAAIRAVVRKAISEGMEVYGINRGYAGMVDGDIFPLGSKEVGDK
ISRGGTFLYSARYPEFAQLEGQLAGIEQLKKHGIEGVVVIGGDGSYHGAMRLTEHGFPAV
GIPGTIDNDIAGTDYTIGFDTAVNTAVEAIDKLRDTSSSHGRTFVVEVMGRNAGDIALWA
GIASGADQIIVPEEEFDIHKVVSTIKDDFENRGKNHHIIVLAEGVMSGEAFAQQLKEAGD
ESDLRVTNLGHILRGGSPTARDRVIASWMGAHAVELLKEGKGGLAVGIHNEELVESPILG
SAEDGALFSLTDEGNIVVNNPHKARLDYAALNRSLAQ
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgtattgctgttttaaccagtggtggtgacgcccctggtatgaatgctgctatt
cgtgcagttgttcgtaaagcaatttcagaaggaatggaagtctatggtattaaccgcggc
tatgctggtatggttgatggtgatatctttccactaggctcaaaagaggttggtgataag
atttctcgcggcgggaccttcctttattcagctcgctacccagagtttgctcagcttgag
gggcaattggctggtattgagcagctaaaaaagcatggcattgaaggggtagttgtcatt
ggtggtgatggttcttaccatggtgcgatgcgcttgactgagcatggcttccctgcagta
ggtatcccagggacgattgataacgatattgctggaacagactatactatcggatttgac
actgcggtcaatactgcggtagaggctattgataagcttcgcgatacctcatcaagtcat
ggacggacctttgttgttgaagtgatgggacgtaatgcaggtgatatcgcactttgggca
ggtattgcaagtggagcagatcaaatcatcgttcctgaagaggaatttgacattcataaa
gtggtctcaacaattaaagacgattttgaaaatagaggaaaaaatcaccatattatcgtt
ttagctgagggtgttatgagtggcgaggcctttgcgcagcagctaaaagaagctggagat
gaaagtgaccttcgtgtgacaaaccttggtcatatccttcgcggtggctctccaactgcg
cgtgatcgtgtgattgcgtcatggatgggagcgcacgctgttgagctgctcaaggaaggc
aaaggcggcttggctgttggtattcataatgaagagcttgttgaaagtccgattcttgga
agtgcagaggacggtgccttgttcagccttactgatgagggtaacattgttgttaataat
ccgcacaaggctcgcttagactatgctgctttgaaccgttcattagcgcaatag

DBGET integrated database retrieval system