KEGG   Streptococcus equi subsp. zooepidemicus MGCS10565: Sez_1031Help
Entry
Sez_1031          CDS       T00746                                 

Gene name
tdk
Definition
thymidine kinase Tdk
Orthology
K00857  
thymidine kinase [EC:2.7.1.21]
Organism
sez  Streptococcus equi subsp. zooepidemicus MGCS10565
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sez00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Sez_1031 (tdk)
Enzymes [BR:sez01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     Sez_1031 (tdk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1069033..1069602)
Genome map
AA seq 189 aa AA seqDB search
MAQLYYKYGTMNSGKTIEILKVAHNYEEQGKPVVIMTSALDTRDGFGIVSSRIGMRREAV
PISSDMDIFAFIAELQEKPYCVLIDECQFLSKQNVYDLARVVDELNVPVMAFGLKNDFQN
ELFEGSKYLLLLADKIDEIKTICQYCSKKATMVLRTEHGKPVYEGAQIQIGGNETYIPVC
RKHYFHPPI
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
ttggctcaattatattacaaatatggaacaatgaattcaggaaagaccattgaaatcttg
aaggtagcacacaattatgaagaacaggggaaacctgttgtgattatgacaagtgcgcta
gacacacgtgatggctttggcattgtttctagtcgaattggcatgcgtcgtgaggccgta
cccatttcgagtgatatggatatttttgcatttattgctgaattgcaggagaagccctat
tgcgtcttgattgacgaatgtcaatttttaagcaagcaaaatgtctatgatttagcacgt
gtggttgatgagctaaatgttccagtgatggcctttggcttaaaaaatgattttcaaaat
gaattgtttgaaggctccaaatacctgttactgttagctgataagattgatgagataaaa
accatctgtcaatattgcagcaaaaaagcaactatggtattgcgaacagaacatggtaag
cccgtttatgagggagcacagattcaaattggtggcaatgagacctatattccagtttgt
cgcaagcattattttcacccaccaatctaa

DBGET integrated database retrieval system