KEGG   Streptococcus equi subsp. zooepidemicus MGCS10565: Sez_1064Help
Entry
Sez_1064          CDS       T00746                                 

Gene name
folE
Definition
GTP cyclohydrolase I
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
sez  Streptococcus equi subsp. zooepidemicus MGCS10565
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sez00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Sez_1064 (folE)
Enzymes [BR:sez01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     Sez_1064 (folE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1097105..1097671)
Genome map
AA seq 188 aa AA seqDB search
MPINQKKAEAAIYQLLEAIGEDPNREGLRDTPKRVAKMYLEMLSGLEKDAKDEFTAVFTE
HHDDLVIVKDISFYSMCEHHLVPFYGKAHIAYLPSDGRVTGLSKLARAVEVASKRPQLQE
RLTAQIANALVDALQPKGVFVMVEAEHMCMTMRGVKKPGSKTITTTARGIYKDSRDDRRE
VMQLIMEG
NT seq 567 nt NT seq  +upstreamnt  +downstreamnt
ttgccaatcaatcaaaaaaaagcagaggcagctatctatcaattattagaggctatcggt
gaggatccaaaccgagaagggctacgagataccccaaagcgtgttgccaagatgtatcta
gaaatgctctcagggctggaaaaggacgctaaggatgaatttacagctgtttttacagag
catcacgacgatttggtgattgttaaggatattagcttttattccatgtgtgagcaccat
ctggtgccgttttatggcaaggcgcatattgcttatttacctagtgatgggcgtgtgaca
ggcttgagtaagctggcaagggcggttgaggtggctagcaaaagacctcagctacaagag
cgcttgacagctcagattgctaatgctcttgttgacgccttgcagcccaaaggggttttt
gttatggtagaagcagagcatatgtgcatgaccatgcgaggtgtcaaaaagccaggcagt
aagaccattacgacaactgccagagggatttacaaggacagtagagacgacaggcgtgag
gttatgcaattaatcatggagggctag

DBGET integrated database retrieval system