KEGG   Streptococcus equi subsp. zooepidemicus MGCS10565: Sez_1077Help
Entry
Sez_1077          CDS       T00746                                 

Gene name
dhfR
Definition
dihydrofolate reductase DhfR
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
sez  Streptococcus equi subsp. zooepidemicus MGCS10565
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sez00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Sez_1077 (dhfR)
   00670 One carbon pool by folate
    Sez_1077 (dhfR)
Enzymes [BR:sez01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     Sez_1077 (dhfR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1112535..1113035)
Genome map
AA seq 166 aa AA seqDB search
MMTKKIIAIWAEDEAGLIGACGRLPWYLPKELQHFKETTLNQAILMGRVTFEGMKGRLLP
NRQTLVMTRDSYYHVEGALTITSVQEALDWYHTQDKTLYVIGGSKVLEAFDGHFDAIIKT
VVHHRFEGDTYSPRLELSDFVEETSVLYPRDDNNSYDFTVTVLRHR
NT seq 501 nt NT seq  +upstreamnt  +downstreamnt
gtgatgacaaagaagattattgctatttgggcagaggatgaagcaggacttatcggagcg
tgtggcaggcttccttggtacctaccaaaagagttgcagcatttcaaggaaacaacattg
aatcaagctatcctgatgggacgagtaacctttgagggcatgaaggggcgtttgctgcca
aatcgccaaacgcttgttatgaccagagacagctattatcatgtggagggcgctttgacc
ataaccagtgtgcaggaggctttggattggtatcatacgcaggataagaccttatatgtg
attggtggcagcaaggttttagaggcctttgatggtcattttgatgcgatcatcaaaaca
gtagtacatcaccggtttgagggtgatacctacagccctaggttagagctgagtgatttt
gtagaggagacctctgtgttgtacccgagggacgataacaattcttacgatttcactgtt
acagtattgagacatcgctaa

DBGET integrated database retrieval system