KEGG   Streptococcus equi subsp. zooepidemicus MGCS10565: Sez_1255Help
Entry
Sez_1255          CDS       T00746                                 

Gene name
malQ
Definition
4-alpha-glucanotransferase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
sez  Streptococcus equi subsp. zooepidemicus MGCS10565
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sez00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Sez_1255 (malQ)
Enzymes [BR:sez01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     Sez_1255 (malQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1286800..1288275)
Genome map
AA seq 491 aa AA seqDB search
MHISSLPGRFGIGSFGKEAFEFVDFLKETKQTYWQILPLTTTSFGDSPYQSFSAIAGNTH
FIDLELLAKDGYLQEADYAAVDFGSNPESVDYAQVFQARRPLLEKAVQAFVSTEEGLRQL
AEFEATASWLNDFAEFMAIKEHFDHKALQEWDDRAIVKREEAALLHYRKLLAKGITYHKV
CQYFFYQQWLALKAYANQNGIAIIGDMPIYVSADSVEVWTMPELFKVDADKKPIYIAGVP
ADGFSEDGQLWGNPIYNWESHEQTGFAWWIHRIKESFKLYDKLRIDHFKGFSDFWEIPGG
DVTAKNGHWESAPGIALFTAVREALGDLPIIAENLGYIDEKAEQLLASTGFPGMKILEFG
LFDVTSQSFDLPHHYDHNCIVYTGTHDNEVVNGWYEHLSAEQVEFVNHYIHKAADESITK
AMLRTIFATVCDTAILCMQDLLDKSADSRMNMPNTVGGNWQWRMLKDDLKEKHKTYLIHL
TELYGRANNHH
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
atgcatatcagctcgcttccgggacgcttcggtattgggagttttggtaaagaggccttt
gaatttgttgactttttaaaggaaaccaagcagacctattggcagattttgcccttaaca
acaactagctttggagattctccttatcaatctttttcagctattgcaggaaatacgcat
tttattgaccttgaattgctagcaaaggacggttatttgcaggaagctgattatgctgct
gttgattttggctcaaatccggagtctgttgattacgctcaagtctttcaagccagacgc
cctttattagaaaaagcagttcaggcttttgtctcaactgaggaaggcttaagacagctc
gccgaatttgaagcaactgcgagctggctaaatgattttgccgaatttatggctattaaa
gagcattttgatcacaaagccctccaggaatgggacgatagagcaattgttaagcgtgaa
gaggctgctttgctccattaccgcaagctgttggccaaaggcatcacctatcataaggtc
tgccaatatttcttttaccagcaatggctagccctaaaggcctatgctaatcaaaatggc
attgctatcattggtgatatgccaatctacgtgtctgctgatagcgttgaggtttggacg
atgccagagctctttaaggtggatgcagataaaaagccgatttacattgcaggtgtacct
gctgatggctttagtgaggacgggcagctttggggcaatcctatttacaactgggagagc
catgagcaaacaggctttgcttggtggatccatcggatcaaagagagcttcaagctgtac
gataagcttagaattgaccatttcaagggcttctcagatttttgggaaattcctggtggt
gatgtgactgctaaaaatggtcattgggagtcagcccctggaattgccttgttcacagct
gtcagagaagctttgggtgatttgccaattatcgcagaaaatcttggctacattgatgaa
aaggcagagcagctgcttgcctcaactggatttccaggcatgaaaattttagagtttggc
ttgtttgatgtgacgagtcaaagctttgatttgccgcatcattatgatcacaattgcatt
gtctacactggtacgcatgacaatgaggtggttaatggctggtatgagcatttgagcgca
gagcaggttgagtttgttaatcattacattcataaggcagctgatgaaagtattaccaag
gccatgctaagaacaatctttgcaactgtttgtgatactgctatcttgtgcatgcaggat
ttgctggataaatcagctgatagccgcatgaatatgccaaacactgttggtggcaactgg
caatggcgcatgcttaaagacgaccttaaagagaagcataagacttacttaatacacttg
actgagctatatggtcgagccaataatcatcactag

DBGET integrated database retrieval system