KEGG   Streptococcus equi subsp. zooepidemicus MGCS10565: Sez_1374Help
Entry
Sez_1374          CDS       T00746                                 

Definition
6-phospho-beta-glucosidase
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
sez  Streptococcus equi subsp. zooepidemicus MGCS10565
Pathway
Glycolysis / Gluconeogenesis
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:sez00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1411219..1412640)
Genome map
AA seq 473 aa AA seqDB search
MVCFPKDFLWGGAVAANQVEGAYLTAGKGLSVQDVLPEGGLGDYTAEPTAANLKLEAIDF
YHRYKEDVALFAEMGFKVFRTSIAWSRIFPQGDETEPNEAGLQFYDDLFDELIAHGIEPL
VTLSHYETPLHLAKTYNGWTDRRMVGFFERFATTVMQRYKNKVKYWLTFNEVNSILHMPF
TSGAIMTPKEKLTPQELYQAIHHELVASASVTRLARLINPAFKIGCMILAMPAYPMTSDP
RDILAAKQFEQRNLLFSDIQVRGKYPSYAKSFFKEQHIDIQFEPGDSELLAQHTVDFLSF
SYYMSVTQSHHPDHYQRGEGNILGGLVNPHLPSSEWGWQIDPIGLRITLNDYYDRYQIPL
FIVENGLGAKDKLVQTKDGHWTVQDDYRIDYMRQHLLQVAKAIEDGVDIMGYTSWGCIDC
VSMSTAQLSKRYGFIYVDRHDDGSGHLTRYKKKSFAWYQRVIETNGRSLSEES
NT seq 1422 nt NT seq  +upstreamnt  +downstreamnt
atggtttgttttccaaaggatttcttgtggggaggggcggttgctgccaatcaggttgag
ggagcttatttaacagctggtaaaggcttgtcggttcaggacgttttaccagaagggggc
ttaggagactatacagctgagccaacagcagctaatttgaagctagaggccatcgatttt
tatcaccgctacaaggaggacgtggcgctctttgcagaaatgggctttaaggttttccgg
acatcaattgcttggtctcgtatttttcctcagggcgatgagacagagcctaacgaagca
gggctacaattttatgacgatttgtttgacgagctgatagcacatggcatagagccttta
gtgaccctatctcactacgaaaccccactgcacctagctaagacctacaatggctggacg
gaccgtcgtatggttggcttctttgaacgttttgcgacaactgtcatgcagcgctacaag
aacaaggtcaagtattggttaaccttcaatgaggttaattcaatcctgcatatgcctttt
accagtggtgctatcatgacaccaaaggaaaagctgactccgcaggagctttatcaagcg
attcaccatgaattagtagcgtctgctagtgtgacaaggcttgctagattgattaaccct
gcttttaaaataggctgtatgattttggctatgccagcctatccaatgacctctgatccg
agggatattttagctgcgaagcagtttgagcaacgtaatctcctgttctcagatattcag
gtcagaggaaaatacccttcctatgctaaatccttttttaaggagcagcacattgacatt
caatttgaaccgggcgacagtgagcttttggcgcagcatacggttgactttttatccttt
agctattacatgagtgtgactcagtctcatcacccggatcattatcaacgaggggagggc
aatattttaggtggcttggttaatcctcatctgccctcttcggaatggggctggcaaatt
gatccaattggccttcgcataaccttgaatgattactatgataggtaccaaattcctctc
tttattgtagaaaatgggcttggcgccaaagataagctagtacagacaaaggatggtcac
tggacagttcaggacgattatcggattgattacatgaggcagcatttattgcaggttgct
aaggctattgaggacggtgttgacattatgggctatacctcctggggctgtattgattgt
gtttctatgtcgactgctcagctaagtaagcgttatggctttatttatgtcgaccgacat
gatgatggcagtggtcacttgacacgctacaagaaaaaatcctttgcttggtatcaaagg
gtcattgagaccaatgggcgtagcctgtctgaggagagctag

DBGET integrated database retrieval system