KEGG   Streptococcus equi subsp. zooepidemicus MGCS10565: Sez_1434Help
Entry
Sez_1434          CDS       T00746                                 

Definition
3-hydroxybutyrate dehydrogenase
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
sez  Streptococcus equi subsp. zooepidemicus MGCS10565
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sez00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    Sez_1434
  Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    Sez_1434
Enzymes [BR:sez01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.30  3-hydroxybutyrate dehydrogenase
     Sez_1434
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1476723..1477496)
Genome map
AA seq 257 aa AA seqDB search
MSKQVVFVTGAASGIGKQIGETFLKEGKIVVFSDINQEKLDAVVDEYTTKGWAADSVLCD
VTNEEAINKAIDYTVEKHGRLDILVNNAGLQHVAMIEDFPTAKYEFMLKVMLTAPFIAIK
RAFPTMKKQGFGRVINMASINGVIGFAGKAAYNSAKHGLIGLTKVAALEAADLGITVNAI
CPGYVDTPLVRGQFEDLSKTRKIPLENVLEEVLYPLVPQKRLIDVQEIADYVSFLASDKA
KGITGQPVILDGGYTAQ
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgtctaaacaagtagtattcgtaacaggtgcagcaagcggtattggtaaacaaattggt
gaaacattcttgaaagagggcaaaatcgttgtcttttcagatatcaatcaagaaaaatta
gatgctgttgttgatgagtataccacaaaaggctgggcggctgattctgttttgtgtgat
gtgacaaatgaagaagcgatcaataaagcgattgattatacagttgaaaagcatggtcgt
ttggatattttggtcaacaacgcaggtttgcagcatgttgccatgattgaagattttcca
acagcaaaatatgaatttatgttgaaggtcatgttgacagcgccatttatcgctattaag
cgcgcttttccaactatgaaaaagcaaggctttggtcgtgtcattaatatggcttctatc
aatggtgtcattggttttgccggaaaagcggcttacaattcagcaaaacatggtttgatt
ggtctgacaaaggttgcagcgcttgaagccgcagatttagggatcacagtcaacgctatc
tgtccaggttatgtggacacaccactcgttcgtggccaatttgaagacctctctaagaca
cgtaagattccgctcgaaaatgtattggaagaagtgttgtacccattggtaccgcaaaaa
cgtttgattgacgtacaagaaattgcagactatgtgtccttccttgcaagtgataaagca
aagggtattaccggtcaaccagttatcttggatggtggttacactgctcaataa

DBGET integrated database retrieval system