KEGG   Streptococcus equi subsp. zooepidemicus MGCS10565: Sez_1496Help
Entry
Sez_1496          CDS       T00746                                 

Gene name
lacZ
Definition
beta-galactosidase LacZ
Orthology
K01190  
beta-galactosidase [EC:3.2.1.23]
Organism
sez  Streptococcus equi subsp. zooepidemicus MGCS10565
Pathway
Galactose metabolism
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:sez00052]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:sez00600]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:sez00511]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1531168..1534611)
Genome map
AA seq 1147 aa AA seqDB search
MSVDAITGPTDQSHGDTYQLHWIDKAGRCHAFSKGWRFLMADLQLAQEPFFDDSDWQQIA
LPHDFSINQPYTINGEAQSAYKLGGVGWYRKYFALDPKLADHKVYVTFDGAYMETQVYLN
GHLIGEHVNGYQAFSYDLSAFVIPGQENLLAVRVEHQVPSSRWYSGSGLYREAFLTVLPK
VHLDKDRLRLSLSQAALEADSQALEIELGLSQQVPLSDYQLSLSLFEQLADTQQRQTVYE
SKPVALDLLEESGRLVMTIPLRHIKLWSPAQPQLYQLDMLLYHKGAVLDRLTLETGFRQL
HFDAECGFFLNGKAFKLQGVCLHHDQGSLGACAYEEAIARQLVLLKEMGANTVRVTHNPS
ARRLKDLANRLGLFLIEEAFDTWTYAKNGNSHDFSSHFHKTVGHQNAARLKGVTTAETTW
AQYSIQAMVLSCLHDPSVLMWSIGNELLEGFSADVSHYPYVAKELCQWITELDQSRPITL
GDNKLKDKHFHWAQETKALAEQVNQLQSVQGVIGLNYAKARDYDRLHRDNPTWLLYGSET
ASAINSRGVYHLKGGASQDHELTSYDQSTVDWGALASEAWYDTITRDFVAGECVWTGFDY
LGEPTPWNKIDSGAADQWPSPKQSYFGILDTAGFAKDSYYFYQSQWSKDKTTLHILPSWQ
EKDLQLDDQGMVEVVVYSNAASVRILFDDGHGGQIDYGIKALTSHETPAGHCYQLYEGDD
AAESPHQNLYLTWKLPYRSGSLRAIAYDDKGQVITQTSGRSCVSSYQQPAQLFWSCFEPP
KLLAEPALIYLELSLLDAHQTLVANANLLINIEVEGPGMCLALDNGDPRDHQPYSSLSRQ
AYGGRLLAIIALDGRAGQLRITARAAGFVEASYQLTVSEAAVKEKLLAYQLDKYSFIINK
TKRQLKAAPRPISQGSDDFAPAADYYVSCQSHCLSDRPVMMFSYATVFTEPLTFQPLTQR
LIKGRDIFLPNWLQPKTAAGQLFTKAFPIDWQLTEAVFSEESRVSGQTLCFGEALELEAI
LKSDTKGLRINQELSLVAKKKRLFQSDTQLSYRYQYDTVQAIGAISLTGLKKPLSSLRLV
LDYRSSTNAPSKQLILSLDQIEQPCHYIMLEEVVDVLSLDLTLEQPIRQAFDLARLQLGL
WSMVEEA
NT seq 3444 nt NT seq  +upstreamnt  +downstreamnt
atgtctgtagatgcaatcactggtccaacggatcaatctcatggggatacctatcagctt
cactggattgataaagcagggcgctgccatgccttttcaaaggggtggcgctttctgatg
gctgatttgcagctcgctcaggagccattttttgatgattcggactggcagcagatagct
ttaccacatgattttagcattaatcagccctatacgattaatggcgaagctcaaagtgcc
tataagctaggtggtgtaggctggtaccggaagtattttgcccttgatccaaagctggct
gaccataaggtttatgtgacctttgatggggcttatatggaaacacaggtataccttaat
ggtcatttgataggagagcatgtcaatggctatcaggcctttagctatgatctctcagcc
tttgtaatccctgggcaagagaatctattagcagttcgggttgaacatcaggtgcctagc
tcgcgttggtattctggaagcgggctttatcgggaggcttttttgaccgttcttcctaag
gttcatcttgataaggatcggcttcgtttatccttatcccaggcagcgcttgaggctgat
agccaagcgcttgagatagagcttggactcagccaacaggtccccttgagtgactatcag
cttagccttagtctgtttgagcagctggcagatacccagcagagacagacagtatatgag
agtaaaccggtagccttggacctcttggaggagtcaggtaggctggtgatgaccattcct
cttaggcatatcaaactgtggtcgccagctcagccccagctctatcagcttgatatgctt
ctttaccataagggagcagtgcttgatcggctgacacttgaaacaggctttcggcagctg
cattttgatgctgagtgtggcttctttttgaatggcaaagcctttaagctgcaaggggtc
tgtcttcatcatgatcagggtagcctgggggcatgtgcttatgaggaagctatagctagg
cagcttgttttgctaaaggaaatgggagcaaatacggttcgtgtcacgcacaaccctagt
gccagaaggcttaaggatctggctaacaggcttggattatttctcattgaggaagccttt
gatacctggacttatgctaaaaacggtaatagccatgatttttcaagccattttcacaag
acagtgggacaccaaaatgcagccaggctaaagggagtcactacagcagaaaccacctgg
gcgcaatatagcatacaggccatggttctctcatgtcttcatgatccatctgtcttgatg
tggtcaatcggcaatgaattgttagaaggcttctcagctgatgtgagtcactacccttat
gttgctaaggagctatgccagtggatcactgagctggatcagtcaagacctattaccctt
ggggataataagctcaaggacaagcattttcattgggctcaggaaacaaaagcgttggca
gagcaggtcaatcagctccagtccgtgcaaggagtgattggacttaattatgctaaggcc
agagattatgatcgattgcatagggacaacccgacttggctgctttatggctcagagaca
gcctctgctattaatagtagaggggtctatcatctcaaaggaggagctagtcaggatcat
gagttgacctcctatgaccagtcaaccgttgactggggggccttggctagtgaggcttgg
tatgatacaatcacaagggattttgttgcaggtgagtgtgtttggacgggctttgattat
ctaggggagcctactccttggaacaagattgactcaggcgcagctgatcagtggccgtcg
cccaagcaatcctactttggtattttagatactgctggatttgctaaggatagctattat
ttctaccaaagccaatggtcaaaagacaaaacgacacttcatatcctgcccagctggcag
gaaaaggaccttcagctagatgatcagggcatggtggaggttgtggtttatagtaatgct
gctagtgtgagaatactttttgatgatggtcatgggggccagattgattatggcatcaag
gctctgacaagtcatgaaacgccagcaggccattgctaccagctatatgagggtgatgac
gcagcagaatcccctcatcaaaacctttacctgacatggaagcttccttatcgctcaggc
agcttgagagctattgcttatgacgacaagggacaggtgatcacacagaccagcggtcgt
tcctgtgtgagcagctaccagcagcctgctcagcttttctggtcttgctttgagcctccc
aagctgcttgcagagcctgccttaatttatcttgaactatccttattagatgcccatcag
accctggtagctaatgctaatctccttatcaacattgaagttgagggtcctggaatgtgc
ttagccttggataatggtgaccctcgtgatcaccagccttatagcagcttgtcgcggcag
gcttatggcggcaggctgctagcgattattgctcttgatggtcgggcaggtcagcttaga
ataacagctagagccgcaggattcgtggaagccagctatcagttgacggtttctgaagca
gccgttaaggagaagcttttagcctatcagcttgataaatacagctttatcattaacaag
acgaaaaggcagctcaaggcagctccaaggccaatcagccaaggctctgatgacttcgca
cctgctgctgattactatgtatcatgccaaagtcactgcttgtctgataggcctgtgatg
atgtttagctatgctacggtatttacagagccattgacctttcagcctctgacgcaaaga
ctgataaaggggagggatatctttctgccaaactggctacagcctaaaacagctgctggc
cagttatttaccaaggcttttcctattgattggcagctaacagaggcagttttttctgag
gagtcaagggttagtgggcagaccctttgttttggagaggctttggagcttgaagctatc
cttaagtcagatacaaaaggattaaggatcaatcaagagcttagcttagttgctaaaaag
aagcggctgtttcagagtgatacccagcttagctaccgctatcaatacgataccgtacag
gccattggtgccattagcctgacaggactaaagaagcccctaagctcgcttaggcttgtt
ttggactatcgcagcagcaccaatgcgccatcaaaacagctgatcctatcgcttgatcag
atagaacagccctgtcactacatcatgctggaagaagtagttgatgtgctaagcctggac
ctaacattagagcagccgatcagacaggcttttgacttagctaggcttcagctaggcctt
tggagcatggttgaggaggcttag

DBGET integrated database retrieval system