KEGG   Streptococcus equi subsp. zooepidemicus MGCS10565: Sez_1678Help
Entry
Sez_1678          CDS       T00746                                 

Definition
N-acyl-L-amino acid amidohydrolase
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
sez  Streptococcus equi subsp. zooepidemicus MGCS10565
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:sez00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Sez_1678
  Amino acid metabolism
   00300 Lysine biosynthesis
    Sez_1678
Enzymes [BR:sez01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     Sez_1678
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1722047..1723417)
Genome map
AA seq 456 aa AA seqDB search
MTKTDQQYLTRLWEDQLTQDYLVSLGQLIASRSIFAQGIGLEETAVYLKELFAQAGAEVI
VDKTYAAPFVLARFNSSRPAAKTLIFYHHYDTVPADNDQKWTSDPFTLTERDGYLFARGV
DDDKGHIIARLTAVVRYLKEHADLPLNIVFMMEGAEESASVDLDRYLAKYADQLKGAELL
IWEQGIRNEHDQLEITGGNKGILTFEMSVDSARCDIHSKYGGVIESAAWYLLQALSSLRN
HRGELLVPGIYQKVVQPTERELDLVETYAIENAQALKKLYGLELPMLQSERRQLLAAYYF
QPSINIQGLWTGYQGQGVKTIIPSQATAKLEVRLVPGLEPEYVFDQIRSYLLNKGFDQIK
LTYTLGEMSYRSDLSSSAISQLIAAAQPFYPKGLSLLPTSAGTGPMHTVFEALQVPIAAF
GLGHSNSCDHAGDENIAIVDYCRHIALIEELITSYE
NT seq 1371 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaaacggatcagcagtacttaacaaggctttgggaggatcagctcacacaggat
tatcttgtgtcgttggggcaattgattgccagtaggtctatttttgctcaaggtatcggc
ttagaagagacagcagtctatctaaaggagctgtttgctcaggctggtgctgaggttatt
gttgataagacttatgcagctccctttgtcctagcacgttttaatagctctaggccagct
gctaagacactgattttttatcatcattacgatacagtgccagcagataatgatcaaaaa
tggacaagcgatccctttaccttaacagagcgtgatggctatttgtttgcgcgcggcgtt
gatgatgacaaggggcatatcattgctagattgactgctgttgtgagatacctaaaggag
catgctgaccttccgcttaatattgtctttatgatggagggagctgaggagtcagcttcg
gtagatttagatcggtatctggctaaatacgcagaccagctaaagggagcagagcttttg
atttgggagcagggcattcgtaatgagcatgatcagcttgaaataactggcggcaataag
gggattttgacctttgagatgtcagtagatagtgctcgttgtgatattcattctaaatat
ggtggtgttattgagtcagctgcctggtatttgcttcaggccctatcaagcttgcggaat
catcgtggggaattgctggtgcctggtatttatcaaaaagtcgttcagccaactgagcga
gagctagatttagttgagacctatgcgattgaaaatgcccaagctctaaaaaagctttac
ggactggagcttcctatgttacaatcagagcgtcgtcaattgttagcagcttattacttt
cagccctccattaacattcaagggctgtggactggctatcaaggacagggggttaagacg
atcattccttcacaggctactgctaaactggaagttcgtttggttcctggcttagagcct
gagtatgtctttgatcagattaggtcttatttgctcaataagggctttgaccagatcaag
ctgacctatactttgggtgagatgagctatcggagtgatctttcatcgtctgctattagt
cagctgattgcagcagctcagcctttttaccctaaggggctatctcttttgccgacatca
gcaggaacaggccctatgcatactgtttttgaagccctgcaggttccgattgccgctttt
ggcttagggcattctaatagttgtgatcatgcaggtgatgaaaacattgctattgtagat
tattgtcggcatattgcattaatagaggagttaataacatcttatgagtga

DBGET integrated database retrieval system