KEGG   Streptococcus equi subsp. zooepidemicus MGCS10565: Sez_1804Help
Entry
Sez_1804          CDS       T00746                                 

Definition
phosphoglycerate mutase family protein
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
sez  Streptococcus equi subsp. zooepidemicus MGCS10565
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:sez00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Sez_1804
   01230 Biosynthesis of amino acids
    Sez_1804
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Sez_1804
  Energy metabolism
   00680 Methane metabolism
    Sez_1804
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Sez_1804
Enzymes [BR:sez01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Sez_1804
Exosome [BR:sez04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Sez_1804
  Exosomal proteins of melanoma cells
   Sez_1804
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1868964..1869533)
Genome map
AA seq 189 aa AA seqDB search
MSDVTQVYFIRHAEPNYQNHNDVTRELSEHGVKASQDLVRQLAEVSIDAFYSSPYKRSID
TIAPLAASRAMEIKLIDDLRERKLADAWIEDFVDTAKKQWADFTFKLPTGESLQEVQDRN
IAALNRILKESRGKTVVIGTHGTALSTIINYYQPDFGFEDFNRCKHVFPWIVRASFDGDQ
LLELYEFLV
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atgtcagatgtaacgcaggtttattttattcgccacgcagagcctaactatcaaaaccac
aacgacgtgactagagagctctccgagcatggggttaaggcgagccaagacctggttagg
caactagcagaggtgtcgattgacgccttttattccagtccctataaacgctctattgac
accattgccccactagcagctagtagggcaatggaaattaagctgattgacgatttgaga
gagcgtaagctagctgatgcttggatagaagactttgttgacacagccaaaaagcagtgg
gctgatttcacctttaaattgccgacaggcgaaagcctgcaagaggtacaagacagaaat
atagcagctcttaaccgtattttaaaagaatcaagaggcaagacagtagtcattggcaca
catggcacagcactgtcaaccatcataaactactatcagcctgactttggctttgaggat
ttcaaccgatgcaagcatgtctttccctggatagtaagagctagctttgatggtgaccag
ctgcttgagctttatgagtttctagtctga

DBGET integrated database retrieval system