KEGG   Streptococcus equi subsp. zooepidemicus MGCS10565: Sez_1804Help
Entry
Sez_1804          CDS       T00746                                 

Definition
(GenBank) phosphoglycerate mutase family protein
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
sez  Streptococcus equi subsp. zooepidemicus MGCS10565
Pathway
sez00010  Glycolysis / Gluconeogenesis
sez00260  Glycine, serine and threonine metabolism
sez00680  Methane metabolism
sez01100  Metabolic pathways
sez01110  Biosynthesis of secondary metabolites
sez01120  Microbial metabolism in diverse environments
sez01130  Biosynthesis of antibiotics
sez01200  Carbon metabolism
sez01230  Biosynthesis of amino acids
Module
sez_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
sez_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:sez00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Sez_1804
  Energy metabolism
   00680 Methane metabolism
    Sez_1804
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Sez_1804
Enzymes [BR:sez01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Sez_1804
Membrane trafficking [BR:sez04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    Sez_1804
Exosome [BR:sez04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Sez_1804
  Exosomal proteins of melanoma cells
   Sez_1804
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: ACG63131
UniProt: B4U5C0
Position
complement(1868964..1869533)
Genome map
AA seq 189 aa AA seqDB search
MSDVTQVYFIRHAEPNYQNHNDVTRELSEHGVKASQDLVRQLAEVSIDAFYSSPYKRSID
TIAPLAASRAMEIKLIDDLRERKLADAWIEDFVDTAKKQWADFTFKLPTGESLQEVQDRN
IAALNRILKESRGKTVVIGTHGTALSTIINYYQPDFGFEDFNRCKHVFPWIVRASFDGDQ
LLELYEFLV
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atgtcagatgtaacgcaggtttattttattcgccacgcagagcctaactatcaaaaccac
aacgacgtgactagagagctctccgagcatggggttaaggcgagccaagacctggttagg
caactagcagaggtgtcgattgacgccttttattccagtccctataaacgctctattgac
accattgccccactagcagctagtagggcaatggaaattaagctgattgacgatttgaga
gagcgtaagctagctgatgcttggatagaagactttgttgacacagccaaaaagcagtgg
gctgatttcacctttaaattgccgacaggcgaaagcctgcaagaggtacaagacagaaat
atagcagctcttaaccgtattttaaaagaatcaagaggcaagacagtagtcattggcaca
catggcacagcactgtcaaccatcataaactactatcagcctgactttggctttgaggat
ttcaaccgatgcaagcatgtctttccctggatagtaagagctagctttgatggtgaccag
ctgcttgagctttatgagtttctagtctga

DBGET integrated database retrieval system