KEGG   Streptococcus equi subsp. zooepidemicus MGCS10565: Sez_1804Help
Entry
Sez_1804          CDS       T00746                                 

Definition
phosphoglycerate mutase family protein
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
sez  Streptococcus equi subsp. zooepidemicus MGCS10565
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:sez00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Sez_1804
   01230 Biosynthesis of amino acids
    Sez_1804
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Sez_1804
  Energy metabolism
   00680 Methane metabolism
    Sez_1804
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Sez_1804
Enzymes [BR:sez01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Sez_1804
Exosome [BR:sez04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Sez_1804
  Exosomal proteins of melanoma cells
   Sez_1804
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1868964..1869533)
Genome map
AA seq 189 aa AA seqDB search
MSDVTQVYFIRHAEPNYQNHNDVTRELSEHGVKASQDLVRQLAEVSIDAFYSSPYKRSID
TIAPLAASRAMEIKLIDDLRERKLADAWIEDFVDTAKKQWADFTFKLPTGESLQEVQDRN
IAALNRILKESRGKTVVIGTHGTALSTIINYYQPDFGFEDFNRCKHVFPWIVRASFDGDQ
LLELYEFLV
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atgtcagatgtaacgcaggtttattttattcgccacgcagagcctaactatcaaaaccac
aacgacgtgactagagagctctccgagcatggggttaaggcgagccaagacctggttagg
caactagcagaggtgtcgattgacgccttttattccagtccctataaacgctctattgac
accattgccccactagcagctagtagggcaatggaaattaagctgattgacgatttgaga
gagcgtaagctagctgatgcttggatagaagactttgttgacacagccaaaaagcagtgg
gctgatttcacctttaaattgccgacaggcgaaagcctgcaagaggtacaagacagaaat
atagcagctcttaaccgtattttaaaagaatcaagaggcaagacagtagtcattggcaca
catggcacagcactgtcaaccatcataaactactatcagcctgactttggctttgaggat
ttcaaccgatgcaagcatgtctttccctggatagtaagagctagctttgatggtgaccag
ctgcttgagctttatgagtttctagtctga

  All links  
No link information was found.   
DBGET integrated database retrieval system