KEGG   Streptococcus equi subsp. zooepidemicus ATCC 35246: SeseC_00051Help
Entry
SeseC_00051       CDS       T02355                                 

Gene name
adhE
Definition
aldehyde-alcohol dehydrogenase 2
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
sezo  Streptococcus equi subsp. zooepidemicus ATCC 35246
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:sezo00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    SeseC_00051 (adhE)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SeseC_00051 (adhE)
   00620 Pyruvate metabolism
    SeseC_00051 (adhE)
   00650 Butanoate metabolism
    SeseC_00051 (adhE)
  Lipid metabolism
   00071 Fatty acid degradation
    SeseC_00051 (adhE)
  Amino acid metabolism
   00350 Tyrosine metabolism
    SeseC_00051 (adhE)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    SeseC_00051 (adhE)
   00626 Naphthalene degradation
    SeseC_00051 (adhE)
Enzymes [BR:sezo01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     SeseC_00051 (adhE)
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     SeseC_00051 (adhE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
53558..56200
Genome map
AA seq 880 aa AA seqDB search
MTEKNSTVETTSVAATIDALVQKGLVALDKMRQLTQEQVDYIVAKASVAALDAHGELAKH
AYEETGRGVFEDKATKNLFACEHVVNNMRHQKTVGIIEEDDVTGLTLIAEPVGVICGITP
TTNPTSTAIFKSLISLKTRNPIIFAFHPSAQESSAHAARIVRDAAIAAGAPEDCVQWIET
PSLEATNALMNHDGIATILATGGNAMVKAAYSCGKPALGVGAGNVPAYVEKSANIRQAAH
DIVMSKSFDNGMVCASEQAVIIDKEIYDEFVSEFKSYHTYFVNKKEKALLEEFCFGAKAN
SKNCAGAKLNPNIVGKPAAWIAEQAGFTVPEGTNILAAECKEVSENEPLTREKLSPVIAV
LKAESRTDGVEKARQMVEFNGLGHSAAIHTADADLAKEFGTKIRAIRVIWNSPSTFGGIG
DVYNAFLPSLTLGCGSYGRNSVGDNVSAVNLLNIKKVGRRRNNMQWFKVPSKTYFERDSI
QYLQKCRDVERVMIVTDHAMVELGFLDRIIEQLDLRRNKVVYQIFADVEPDPDITTVMKG
TELMRTFKPDTIIALGGGSPMDAAKVMWLFYEQPEVDFHDLVQKFMDIRKRAFKFPELGK
KTKFVAIPTTSGTGSEVTPFAVISDKANNRKYPIADYSLTPTVAIVDPALVLTVPGFIAA
DTGMDVLTHATEAYVSQMANDFTDGLALQAIKIVFENLEKSVKEADFESREKMHNASTMA
GMAFANAFLGISHSMAHKIGAQFHTVHGRTNAILLPYVIRYNGTRPAKTATWPKYNYYRA
DEKYQDIAKLLGLPASTPEEGVESYAKAVYDLGCRLGIKMNFRDQGIDEEEWKAHTRELA
YLAYEDQCSPANPRLPMVEHMEEIMNDAYYGYAERPGRRK
NT seq 2643 nt NT seq  +upstreamnt  +downstreamnt
atgactgaaaaaaatagtactgttgaaacaacatctgttgccgcaacaattgacgctctt
gttcaaaaaggtttagtagcgcttgataaaatgcgccaattaactcaagaacaggttgac
tacattgtagcgaaggcctctgttgctgctttggacgcacatggtgagttagctaagcat
gcctatgaagaaactggtcgcggagtttttgaagataaggctaccaaaaaccttttcgca
tgtgagcacgttgttaataacatgcgtcaccaaaaaacagtaggtatcattgaagaagac
gatgtaacaggtttgaccttaattgctgagccagtaggtgttatttgtgggattacccca
acaactaacccaacgtcaacagctatttttaaatctttaatctccttaaaaacacgtaac
cctattatttttgccttccacccatcagctcaagaatcatcagctcatgcagcacgcatt
gttcgtgatgcagcgattgcagcaggagctcctgaggactgtgttcaatggattgaaacc
ccatcactagaagcaactaacgctctgatgaatcatgatggtattgcaacaatccttgca
actggtggtaatgctatggttaaggcagcctactcatgtggtaagccagctcttggggtt
ggtgctggtaacgtgcctgcctatgttgaaaaatccgctaacattcgtcaggcagcacac
gatattgtcatgtctaaatcatttgacaatggtatggtttgtgcttctgagcaggctgtt
attatcgacaaggagatttatgacgagtttgttagtgaatttaagtcttaccacacttac
tttgtcaacaaaaaggaaaaggctctgttagaggaattctgctttggtgctaaggctaac
agtaaaaactgtgcaggtgctaagctgaaccctaatattgttggtaagccagcagcttgg
attgctgagcaggcaggctttacagtaccagaaggaacgaatatccttgcagcagaatgt
aaggaagtttctgaaaatgagccattaacacgtgaaaaattgtcaccagttatcgctgtt
ttgaaggctgaatctcgcacagatggtgttgaaaaggctcgtcaaatggttgaatttaac
ggacttggtcactcagccgctattcatactgctgatgcagacttagctaaggaatttgga
acaaaaattcgtgctattcgtgtgatttggaattcaccttctacatttggtggtatcggt
gatgtttataatgccttcctaccgtcattaacattgggctgtggttcttatggacgtaac
tcagttggtgataatgttagtgctgtaaatctcttgaacatcaaaaaagtaggaagacgt
agaaataatatgcaatggtttaaagttccttcaaaaacatacttcgagcgtgattcaatt
caataccttcaaaaatgtcgtgacgttgagcgtgtgatgattgttaccgaccacgctatg
gttgagcttggcttcttagatcgtatcatcgagcagcttgaccttcgtcgtaataaggtt
gtttatcaaatttttgcagatgttgagccagatcctgatatcacaacggttatgaaaggt
actgagctgatgcgtaccttcaagccagatacgattatcgctcttggcggtggttctcca
atggacgctgcaaaggtaatgtggttattctatgagcaaccagaggttgacttccatgat
cttgttcaaaaattcatggatattcgtaagcgtgccttcaagttccctgagcttggtaag
aaaacaaaatttgtggctattccaacaacctcaggtacaggatcagaggttacaccgttt
gctgttatctcagataaggccaacaaccgcaagtacccaattgctgactattcattgaca
ccaacggtagccattgttgacccggcgttggtgcttacagtaccaggcttcattgcagct
gatacaggtatggacgtgttgacccacgcaaccgaggcttacgtatcacaaatggctaat
gactttacagacggtttggcccttcaagccattaagattgtctttgaaaaccttgaaaaa
tctgttaaggaagctgactttgagtcacgtgaaaaaatgcataatgcctcaacaatggca
ggtatggcctttgctaatgccttcctgggtatttctcactcaatggctcataagattggt
gcacaattccatactgttcatggacgtaccaatgctatcttgcttccatacgttattcgt
tacaatggtacccgtcctgctaaaacagcaacatggcctaagtacaattactatcgcgcc
gatgaaaaatatcaagacattgctaagttgctaggacttccggcatctactccagaagaa
ggtgttgaatcttatgctaaagctgtttatgatcttggctgtcgcttaggcattaagatg
aatttcagagatcaaggaattgatgaggaagaatggaaggcacacactcgtgagcttgct
tatcttgcctacgaggatcaatgctcacctgctaacccacgcttgccaatggttgagcac
atggaagaaatcatgaatgatgcttattatggttacgcagagcgtccaggacgtcggaaa
taa

  All links  
No link information was found.   
DBGET integrated database retrieval system