KEGG   Streptococcus equi subsp. zooepidemicus ATCC 35246: SeseC_00054Help
Entry
SeseC_00054       CDS       T02355                                 

Gene name
adhP
Definition
(GenBank) alcohol dehydrogenase
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
sezo  Streptococcus equi subsp. zooepidemicus ATCC 35246
Pathway
sezo00010  Glycolysis / Gluconeogenesis
sezo00071  Fatty acid degradation
sezo00625  Chloroalkane and chloroalkene degradation
sezo00626  Naphthalene degradation
sezo01100  Metabolic pathways
sezo01110  Biosynthesis of secondary metabolites
sezo01120  Microbial metabolism in diverse environments
sezo01130  Biosynthesis of antibiotics
sezo01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:sezo00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SeseC_00054 (adhP)
  Lipid metabolism
   00071 Fatty acid degradation
    SeseC_00054 (adhP)
  Amino acid metabolism
   00350 Tyrosine metabolism
    SeseC_00054 (adhP)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    SeseC_00054 (adhP)
   00626 Naphthalene degradation
    SeseC_00054 (adhP)
Enzymes [BR:sezo01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     SeseC_00054 (adhP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 TrkA_N DUF2675 ADH_N_2 Methyltransf_25 Methyltransf_31 Sacchrp_dh_NADP
Motif
Other DBs
NCBI-ProteinID: AEJ24278
Position
57950..58966
Genome map
AA seq 338 aa AA seqDB search
MKAVVVNQTSSGVEVVEHDVPSIGHGEALVKVEYCGVCHTDLHVAHGDFGQVPGRILGHE
GIGIVEKLGEGVTSLKVGDRVSIAWFFEGCGHCEYCTTGRETLCRSVKNAGYSVDGGMSE
YAVVTADYAVKVPDGLDPAQASSITCAGVTTYKAIKEAGAAPGQWIVIFGAGGLGNLAVQ
YAKKVFNAHVVAVDINNDKLELAKEVGADIVVNGKEIEDVAGYIQEKTGGAHGVVVTAVS
KVAFNQAIDSVRAGGTVVAVGLPSEYMELSIVKTVLDGIKVVGSLVGTRKDLEEAFAFGA
EGLVVPVVEKVPVETAPEVFDEMERGLIQGRKVLDFTL
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgaaggctgtagttgttaaccaaaccagcagtggtgtagaggttgtagagcatgatgta
ccatcaatcggtcatggagaagctcttgttaaagtagaatattgtggcgtatgtcatact
gacttgcatgttgcacatggtgattttggtcaggttccggggcgtatcctcggtcatgaa
ggtatcggtattgttgaaaagctaggtgaaggcgttacctccttaaaggttggtgatcgt
gtatcaattgcttggttctttgaaggctgcggtcactgtgaatattgtacaacaggtcgc
gaaaccctatgccgttcagtcaaaaatgctggctattcagttgatggtgggatgagtgag
tatgcagttgtgacagctgattacgctgtgaaagtaccagatggtcttgacccagctcaa
gcatcatcaattacctgtgcaggtgttacaacctataaggctatcaaggaggcaggtgca
gctccaggacaatggattgttatctttggtgccggtggacttggtaacttagctgttcag
tatgctaaaaaggttttcaatgcccatgttgtagcagtggacattaacaacgataagcta
gagctggccaaggaggttggagcagatatcgttgtcaatggtaaagaaatcgaagatgtt
gcaggctatatccaagaaaaaacaggtggtgctcatggcgttgtggtaaccgctgtttct
aaagtagcctttaaccaagctattgatagtgtgcgtgcaggaggaactgttgttgctgta
ggacttccatcagaatacatggaattatctatcgtaaagactgtcctagacggaatcaag
gtagtcggatcacttgtgggaactcgtaaagacttggaagaagcctttgcctttggtgca
gaaggtctggttgtgccagttgtagaaaaggttccagttgagactgctccagaagtcttt
gacgaaatggaacgtggtctcattcaaggaagaaaggtattggatttcacgctttaa

DBGET integrated database retrieval system