KEGG   Streptococcus equi subsp. zooepidemicus ATCC 35246: SeseC_00054Help
Entry
SeseC_00054       CDS       T02355                                 

Gene name
adhP
Definition
(RefSeq) alcohol dehydrogenase
  KO
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
sezo  Streptococcus equi subsp. zooepidemicus ATCC 35246
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:sezo00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    SeseC_00054 (adhP)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SeseC_00054 (adhP)
  Lipid metabolism
   00071 Fatty acid degradation
    SeseC_00054 (adhP)
  Amino acid metabolism
   00350 Tyrosine metabolism
    SeseC_00054 (adhP)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    SeseC_00054 (adhP)
   00626 Naphthalene degradation
    SeseC_00054 (adhP)
Enzymes [BR:sezo01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     SeseC_00054 (adhP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
57950..58966
Genome map
AA seq 338 aa AA seqDB search
MKAVVVNQTSSGVEVVEHDVPSIGHGEALVKVEYCGVCHTDLHVAHGDFGQVPGRILGHE
GIGIVEKLGEGVTSLKVGDRVSIAWFFEGCGHCEYCTTGRETLCRSVKNAGYSVDGGMSE
YAVVTADYAVKVPDGLDPAQASSITCAGVTTYKAIKEAGAAPGQWIVIFGAGGLGNLAVQ
YAKKVFNAHVVAVDINNDKLELAKEVGADIVVNGKEIEDVAGYIQEKTGGAHGVVVTAVS
KVAFNQAIDSVRAGGTVVAVGLPSEYMELSIVKTVLDGIKVVGSLVGTRKDLEEAFAFGA
EGLVVPVVEKVPVETAPEVFDEMERGLIQGRKVLDFTL
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgaaggctgtagttgttaaccaaaccagcagtggtgtagaggttgtagagcatgatgta
ccatcaatcggtcatggagaagctcttgttaaagtagaatattgtggcgtatgtcatact
gacttgcatgttgcacatggtgattttggtcaggttccggggcgtatcctcggtcatgaa
ggtatcggtattgttgaaaagctaggtgaaggcgttacctccttaaaggttggtgatcgt
gtatcaattgcttggttctttgaaggctgcggtcactgtgaatattgtacaacaggtcgc
gaaaccctatgccgttcagtcaaaaatgctggctattcagttgatggtgggatgagtgag
tatgcagttgtgacagctgattacgctgtgaaagtaccagatggtcttgacccagctcaa
gcatcatcaattacctgtgcaggtgttacaacctataaggctatcaaggaggcaggtgca
gctccaggacaatggattgttatctttggtgccggtggacttggtaacttagctgttcag
tatgctaaaaaggttttcaatgcccatgttgtagcagtggacattaacaacgataagcta
gagctggccaaggaggttggagcagatatcgttgtcaatggtaaagaaatcgaagatgtt
gcaggctatatccaagaaaaaacaggtggtgctcatggcgttgtggtaaccgctgtttct
aaagtagcctttaaccaagctattgatagtgtgcgtgcaggaggaactgttgttgctgta
ggacttccatcagaatacatggaattatctatcgtaaagactgtcctagacggaatcaag
gtagtcggatcacttgtgggaactcgtaaagacttggaagaagcctttgcctttggtgca
gaaggtctggttgtgccagttgtagaaaaggttccagttgagactgctccagaagtcttt
gacgaaatggaacgtggtctcattcaaggaagaaaggtattggatttcacgctttaa

DBGET integrated database retrieval system