KEGG   Streptococcus equi subsp. zooepidemicus ATCC 35246: SeseC_00056Help
Entry
SeseC_00056       CDS       T02355                                 

Gene name
thrC
Definition
threonine synthase
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
sezo  Streptococcus equi subsp. zooepidemicus ATCC 35246
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:sezo01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:sezo00260]
Metabolism; Metabolism of cofactors and vitamins; Vitamin B6 metabolism [PATH:sezo00750]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
59767..61251
Genome map
AA seq 494 aa AA seqDB search
MPMMYQSTRNAANKVTASQAILSGLADDGGLFTPTSMPVLDLDFEELKTKSYQEVAKLIL
SAFFDDYTEAELDACISSAYDDKFDTAVIAPLATLKDYHNLELFHGSTIAFKDMALSILP
YLLTTAAKKQGVERKIAILTATSGDTGKAAMAGFADVPGTDIIVFYPKSGVSRIQELQMI
TQAGHNTHVVAIEGNFDDAQTEVKRLFNDPDLRERLAAQQIQLSSANSMNIGRLIPQVVY
YIYAYAQLVRHQRLEAGETINIVVPTGNFGNLLAAYYAKEIGLPVAKFICASNENNVLTD
FFASGRYDKKRPLKVTTSPSMDILVSSNLERLVFHLLGNDAQKTAALMKSLAETGQYQLA
DADQSILDLFAAGFATEQETAKEIKTIFESDHYVLDPHTAVASAVYRAYREQSGDSRPTI
VASTASPYKFPRVVVEAISGQQVASDFEALEQLADISGVVVPQAVNGLQEAPIRHSLLVT
VADMQQAVEAYLGV
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atgccaatgatgtaccaatcaacaagaaatgcagctaataaggtaacagctagtcaagcg
attttaagtggcctagcagacgatggtggcttgtttactcctacaagcatgccagtgctg
gatctagattttgaggagctaaagaccaagtcctatcaagaggttgccaagcttatttta
tcagccttttttgatgactatactgaagcagaattagatgcttgtatctcttctgcctat
gatgataagtttgatacagcagtgatagcacctctagctacgttaaaggattatcataat
ttggagctatttcatggttcaaccatcgcatttaaggacatggctctatctattttgcct
tatctcttgacaactgctgctaaaaagcaaggtgtggagcgaaaaattgcgattttaacc
gctacctcaggtgatactggtaaggcagcaatggcaggctttgctgatgttccgggaacg
gatattattgtcttttatcctaagtcaggcgttagcaggattcaggagctgcagatgatc
acacaggctggtcacaatacccatgttgtggcgattgaaggcaattttgatgatgctcaa
acagaggtcaagcgcctgtttaatgaccctgatttgcgtgagcggctagcggcccaacag
atacagctgtcttcggccaattcgatgaatattggtcgtttgattcctcaggttgtctat
tatatttatgcttatgcccagttggtaaggcatcagcgacttgaagctggagagacgatt
aacatagtagtgccgacaggaaattttggcaatctactggctgcctactacgccaaagaa
attggacttcctgttgccaaattcatctgtgcttccaatgaaaacaatgtcctgacagat
ttctttgctagtggtaggtatgataaaaagcgtcccctcaaggtgactactagtccatca
atggatattttggtgtcttcaaatttagagcgcttggtttttcatttactaggcaatgat
gcccaaaagacagcagcattaatgaagagcttggcagaaacaggtcagtatcagctagct
gatgcagatcagtctatccttgatttatttgcggcaggctttgcaacagagcaagagact
gctaaagagatcaaaacgatatttgagtctgatcattatgtgcttgacccacatacagct
gtagcttcagctgtttatcgtgcttatcgggagcaatcaggtgactctagaccgactatt
gttgcgtcaactgctagtccttataagtttccgcgggtagttgtggaagctattagtggt
cagcaggttgccagtgattttgaggcgcttgagcagttggctgatatatcaggtgtagtc
gtgccacaagcggtcaatggcttacaggaggcgcccattcgtcatagccttttagtgaca
gtagcagatatgcagcaggcagtggaggcttatcttggagtatag

DBGET integrated database retrieval system