KEGG   Streptococcus equi subsp. zooepidemicus ATCC 35246: SeseC_00097Help
Entry
SeseC_00097       CDS       T02355                                 

Gene name
ispE
Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
sezo  Streptococcus equi subsp. zooepidemicus ATCC 35246
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:sezo00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
94057..94908
Genome map
AA seq 283 aa AA seqDB search
MTAIIERAPAKINLGLDIQGKRPDGYHDLSMVLVSVDLCDYITVDHLEEDRILLTSNCPR
LPINEHNDVYKAAYLLKERFQISTGVSIFLDKRVPVCAGMGGGSSDAAAAIRALNQLWQL
KLSPRQMIDIGMQIGSDVPYCLFAGCAQVTGKGEVVKPINGRLSSWVVLVKPEFGISTRT
IFWDIDCETISRVPIEDLVSAIEAGDYQRLLATMGNSLEDISIAKRPFIQKVKDKMLQSG
ADIALMTGSGPTVFALCQTEKQANRVVNSLKGFCKEVYKVRTL
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atgactgcaatcattgagagagctcctgcaaaaataaatctaggcttagatattcaaggc
aagcgaccagatggctatcatgacctgtctatggttctagttagtgtagatctttgtgat
tatattacagtggatcatttagaggaggataggattttattgacctctaattgccctaga
ttgcctatcaatgagcacaatgacgtttacaaggcggcttatttgctgaaagagcgattt
caaatctcaacaggtgtctctattttcttggataagagggtacctgtttgtgctggtatg
ggaggtggctcaagtgatgcggctgcagcaatcagagcattgaatcagctgtggcagcta
aagcttagtccccgtcagatgattgacattggcatgcagattggtagcgatgtgccttat
tgtctttttgcaggctgcgcccaagtgactggcaaaggcgaggtggttaagccaatcaat
ggccgcttgtcctcttgggtggttctagtgaagccagaatttggcatttctactagaacg
attttttgggatattgattgtgagacgatatctcgagtgccgattgaggatctggtttca
gccattgaggcaggtgattatcagcgcttgcttgcaacgatgggaaattccttagaggat
atttccattgctaaacggccgtttattcaaaaggttaaggataaaatgttgcagtcagga
gcagacattgccctgatgacaggaagtggtccaacggtatttgccctatgtcaaacagaa
aaacaggccaatcgtgtggtgaatagcctgaaaggcttttgtaaggaagtctacaaggtt
agaacgctgtag

DBGET integrated database retrieval system