KEGG   Streptococcus equi subsp. zooepidemicus ATCC 35246: SeseC_00255Help
Entry
SeseC_00255       CDS       T02355                                 

Gene name
galU
Definition
UTP--glucose-1-phosphate uridylyltransferase HasC.2
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
sezo  Streptococcus equi subsp. zooepidemicus ATCC 35246
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:sezo00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    SeseC_00255 (galU)
   00052 Galactose metabolism
    SeseC_00255 (galU)
   00500 Starch and sucrose metabolism
    SeseC_00255 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    SeseC_00255 (galU)
Enzymes [BR:sezo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     SeseC_00255 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(224968..225936)
Genome map
AA seq 322 aa AA seqDB search
MNFAQKTNGTHKEPQIKEELMTKVRKAIIPAAGLGTRFLPATKALAKEMLPIVDKPTIQF
IVEEALKAGIEEILVVTGKAKRSIEDHFDSNFELEYNLQAKGKTELLKLVDETTAINLHF
IRQSHPRGLGDAVLQAKAFVGNEPFVVMLGDDLMDITNPSAKPLTKQLIEDYDCTHASTI
AVMRVPHEEVSNYGVIAPQGKAVKGLYSVETFVEKPSPDEAPSDLAIIGRYLLTPEIFAI
LENQAPGAGNEVQLTDAIDKLNKTQRVFAREFKGERYDVGDKFGFMKTSLDYALKHPQVK
DDLADYIIKLGKALESTQQQAK
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgaatttcgctcagaaaacgaatggcactcataaggaaccacaaatcaaggaggaactc
atgacaaaggtcagaaaagccattatcccagccgccggcctaggcactcgcttcctaccc
gccaccaaggcactggccaaggaaatgctcccaatcgtcgataagccaaccattcaattc
atcgtcgaggaagctctaaaggccggtatcgaggagattcttgtcgtcaccggcaaggcc
aaacgctctattgaagaccactttgactccaacttcgagctcgaatacaatctccaagcc
aagggcaaaaccgagctgctcaagctcgttgatgagaccactgccatcaacctgcacttc
attcgtcagagccaccctagaggactaggggacgctgtcctccaggccaaggcctttgtg
ggcaatgagccctttgtggtcatgctgggggatgacctcatggatattaccaatcctagt
gccaagcccttgaccaagcagctcattgaggattatgattgcacacacgcctcaacgatt
gcagtgatgagggtgccgcatgaggaggtttccaattatggcgtgattgcaccgcaaggg
aaggctgttaagggcttgtatagtgtggagacctttgttgagaagccaagtccagatgag
gcaccgagtgacttagcgattattggtcgatatttgttgacgcctgagatttttgccata
ttggagaatcaggcgcctggggctggcaatgaggtacagctgaccgatgcgattgacaag
ctcaacaagactcagcgggtttttgcgagggagtttaagggagagcggtatgatgttggg
gacaagtttggctttatgaagacctcacttgactatgctctcaagcaccctcaggtcaag
gacgacctcgctgactacatcataaagctgggtaaagcactagaaagcactcaacagcaa
gcaaaatag

DBGET integrated database retrieval system