KEGG   Streptococcus equi subsp. zooepidemicus ATCC 35246: SeseC_00255Help
Entry
SeseC_00255       CDS       T02355                                 

Gene name
galU
Definition
(GenBank) UTP--glucose-1-phosphate uridylyltransferase HasC.2
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
sezo  Streptococcus equi subsp. zooepidemicus ATCC 35246
Pathway
sezo00040  Pentose and glucuronate interconversions
sezo00052  Galactose metabolism
sezo00500  Starch and sucrose metabolism
sezo00520  Amino sugar and nucleotide sugar metabolism
sezo01100  Metabolic pathways
sezo01130  Biosynthesis of antibiotics
Module
sezo_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:sezo00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    SeseC_00255 (galU)
   00052 Galactose metabolism
    SeseC_00255 (galU)
   00500 Starch and sucrose metabolism
    SeseC_00255 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    SeseC_00255 (galU)
Enzymes [BR:sezo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     SeseC_00255 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 IspD
Motif
Other DBs
NCBI-ProteinID: AEJ24442
Position
complement(224968..225936)
Genome map
AA seq 322 aa AA seqDB search
MNFAQKTNGTHKEPQIKEELMTKVRKAIIPAAGLGTRFLPATKALAKEMLPIVDKPTIQF
IVEEALKAGIEEILVVTGKAKRSIEDHFDSNFELEYNLQAKGKTELLKLVDETTAINLHF
IRQSHPRGLGDAVLQAKAFVGNEPFVVMLGDDLMDITNPSAKPLTKQLIEDYDCTHASTI
AVMRVPHEEVSNYGVIAPQGKAVKGLYSVETFVEKPSPDEAPSDLAIIGRYLLTPEIFAI
LENQAPGAGNEVQLTDAIDKLNKTQRVFAREFKGERYDVGDKFGFMKTSLDYALKHPQVK
DDLADYIIKLGKALESTQQQAK
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgaatttcgctcagaaaacgaatggcactcataaggaaccacaaatcaaggaggaactc
atgacaaaggtcagaaaagccattatcccagccgccggcctaggcactcgcttcctaccc
gccaccaaggcactggccaaggaaatgctcccaatcgtcgataagccaaccattcaattc
atcgtcgaggaagctctaaaggccggtatcgaggagattcttgtcgtcaccggcaaggcc
aaacgctctattgaagaccactttgactccaacttcgagctcgaatacaatctccaagcc
aagggcaaaaccgagctgctcaagctcgttgatgagaccactgccatcaacctgcacttc
attcgtcagagccaccctagaggactaggggacgctgtcctccaggccaaggcctttgtg
ggcaatgagccctttgtggtcatgctgggggatgacctcatggatattaccaatcctagt
gccaagcccttgaccaagcagctcattgaggattatgattgcacacacgcctcaacgatt
gcagtgatgagggtgccgcatgaggaggtttccaattatggcgtgattgcaccgcaaggg
aaggctgttaagggcttgtatagtgtggagacctttgttgagaagccaagtccagatgag
gcaccgagtgacttagcgattattggtcgatatttgttgacgcctgagatttttgccata
ttggagaatcaggcgcctggggctggcaatgaggtacagctgaccgatgcgattgacaag
ctcaacaagactcagcgggtttttgcgagggagtttaagggagagcggtatgatgttggg
gacaagtttggctttatgaagacctcacttgactatgctctcaagcaccctcaggtcaag
gacgacctcgctgactacatcataaagctgggtaaagcactagaaagcactcaacagcaa
gcaaaatag

DBGET integrated database retrieval system