KEGG   Streptococcus equi subsp. zooepidemicus ATCC 35246: SeseC_00268Help
Entry
SeseC_00268       CDS       T02355                                 

Gene name
gltX1
Definition
glutamyl-tRNA synthetase
Orthology
K09698  
nondiscriminating glutamyl-tRNA synthetase [EC:6.1.1.24]
Organism
sezo  Streptococcus equi subsp. zooepidemicus ATCC 35246
Pathway
Aminoacyl-tRNA biosynthesis
Metabolic pathways
Module
Aminoacyl-tRNA biosynthesis, prokaryotes
Brite
KEGG Orthology (KO) [BR:sezo00001]
 Genetic Information Processing
  Translation
   00970 Aminoacyl-tRNA biosynthesis
    SeseC_00268 (gltX1)
Enzymes [BR:sezo01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.24  glutamate---tRNAGln ligase
     SeseC_00268 (gltX1)
Amino acid related enzymes [BR:sezo01007]
 Aminoacyl-tRNA synthetase
  Class I (A)
   SeseC_00268 (gltX1)
Transfer RNA biogenesis [BR:sezo03016]
 Prokaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    SeseC_00268 (gltX1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
238258..239703
Genome map
AA seq 481 aa AA seqDB search
MSKPIRVRYAPSPTGLLHIGNARTALFNYLYARHHGGDFIIRIEDTDRKRHVEDGERSQL
ENLKWLGIDWDESPETHERYRQSERLALYQQYIDQLLAEGKAYKSYVTEEELAAERERQE
AAGETPRYVNEYLGMSADEKAAYIAEREAAGIVPTVRLAVNEAGIYKWTDMVKGDIVFEG
GNIGGDWVIQKKDGYPTYNFAVVIDDHDMQISHVIRGDDHIANTPKQLMVYEALGWEAPV
FGHMTLIINSETGKKLSKRDTNTLQFIEDYRKKGYMPEAVFNFIALLGWNPGGEAEIFSR
EQLIALFDESRLSKSPAAFDQKKMDWMSNEYFKHADLGAVYALCKPFLEAAGRLSEKAEK
LVELYQPQLSSADEIVPLTDLFFSDFPELTAKEKEVMAAETVPTVLKAFKEKLEAMSDED
FKPENIFPQIKAVQKETGIKGKNLFMPIRIAVSGEMHGPELPNTIYLLGREQSIEHIANM
L
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
atgtctaaaccaattcgtgtgcgctatgcaccaagcccaacaggccttttacatatcgga
aatgcgcggacagcgctctttaactatctttatgctcgtcatcatggcggtgactttatt
attcgtattgaagatactgatcgtaagcgtcatgtcgaggacggcgagcgttctcagctg
gaaaatttaaaatggcttggtatagattgggacgaaagtcctgagacgcacgagcgttat
cgtcagtcagagcgtctagccctttatcaacaatacattgaccaattattggcagaaggc
aaggcttacaagtcttatgtgactgaggaggagctggcagcagagcgtgagcgtcaagag
gcagctggtgaaacacctcgctatgtcaatgaataccttggcatgtcagcagatgaaaag
gcggcctatatcgcagagcgtgaggcagctggtattgtacctacggttcgtttggctgtc
aatgaggctggtatttacaaatggacagacatggtaaaaggcgatattgtatttgagggt
ggcaacatcggtggtgactgggtgatccagaaaaaagacggctatccaacctacaatttt
gctgttgttattgatgatcacgatatgcaaatctcacacgttatccgcggagatgaccat
attgccaatacgccaaagcagttgatggtttatgaggcgcttggctgggaagcacccgtc
tttggtcatatgacccttatcattaattctgagacaggtaaaaagctatcaaagcgtgat
accaataccctgcagtttattgaggattatcgtaaaaaaggctatatgccagaggcagtc
tttaattttattgcccttttgggctggaatcctggcggggaggctgagatcttttctcgt
gagcaattgattgccttatttgatgagagtcgtcttagcaagtcgccagcagcctttgac
cagaaaaaaatggactggatgagcaatgagtactttaagcatgctgatcttggcgctgta
tatgcgctttgtaagccatttcttgaagcagcaggccgcttgtctgaaaaagcagagaag
ctagttgagctctatcagcctcaattaagctctgctgatgagattgttccattgactgat
ttatttttctcagatttcccagagctgaccgcaaaagaaaaagaagtgatggcagctgag
actgttccaacagttctgaaggccttcaaggaaaagctagaggcgatgtcagatgaggac
tttaagccagaaaacattttcccacaaatcaaggctgtccaaaaagaaaccggcattaag
ggcaagaacctctttatgccaattcgtattgctgtttctggagaaatgcatggcccagag
ctgccaaataccatttacctccttggacgtgaacaatcgattgagcatattgccaatatg
ctttaa

  All links  
No link information was found.   
DBGET integrated database retrieval system