KEGG   Streptococcus equi subsp. zooepidemicus ATCC 35246: SeseC_00388Help
Entry
SeseC_00388       CDS       T02355                                 

Gene name
recD
Definition
exodeoxyribonuclease V alpha chain
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
sezo  Streptococcus equi subsp. zooepidemicus ATCC 35246
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:sezo00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    SeseC_00388 (recD)
Enzymes [BR:sezo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     SeseC_00388 (recD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(328493..330997)
Genome map
AA seq 834 aa AA seqDB search
MLTKHSASFRKAAIVDVLKPAVVQVFDYLAQKGTVMEHFFTGTVDRIIFDNASNFFKILL
LAIEDTDSDFDEADIVITGTMAEIIEGEAYTFWGELTQHPRYGQQLRLSRYQKAKPTSAG
LVSYFSSEHFKGIGQKTAEKIIALYGNNPIDDILKNPSRLNEISSLSKANREAFVAKLKA
NYGTEQVIAALADLGLANRFAFQLFDKYKEEAVHIVKDNPYQLIEDIQGFGFKLADSLAE
QLGIESDSPKRFRAALLHCLLEQSIKRGDTYIQARELLALTISLLEDTRPVECDPAIVAN
QLTQLIDEGKVMTIGTRVFDSSLYYAEEGIQKHLTRLLQQPLTKELSQDTIDQEIQAIQE
EFAITYDKIQKQAISQALTSKVFILTGGPGTGKTTVIRGILQAYASLHQIDLKKKDIPII
LAAPTGRAARRMNELTGLASATIHRHLGLNGDNDYQAMEDYLDCDLLIVDEFSMVDTWLA
NQLLTAISSNTQLIIVGDSDQLPSVGPGQVLADLLKVDRIPHITLDKIFRQSEESTIVDL
ANHIRQGILAPDFCQKKADRSYFEAQAPFIPGMMTKIVQAALKSGIPAEEIQILAPMYKG
LAGINSLNQLMQNLLNPLADQTEFLFNETAFRKGDKVLHLVNDAQLNVFNGDIGYITDLI
PAKYTESKQDEIVIDFDGTEIVYPRNEWLKITLAYAMSIHKSQGSEFQVVILPVTRQSGR
LLQRNLIYTAITRSKSKLIMLGEIAAFEEAIKKEGDKRHTYLVQRLQAEEADNHIAAASA
NESNQSSLSVKPAPSPQKEQEQPPYLLTPHNFLAIDPMIGLTEDDMLTFFKKKS
NT seq 2505 nt NT seq  +upstreamnt  +downstreamnt
gtgctaaccaagcactcagctagctttagaaaagcagctattgttgacgttctaaaacct
gccgttgtgcaggttttcgactatcttgcacagaaaggtaccgtcatggaacactttttt
acaggcactgttgaccgaattatctttgacaatgcgtcaaattttttcaaaattctatta
ctggctatagaggatactgatagtgattttgatgaagctgacattgtcattacaggcact
atggctgagatcatagagggcgaagcctataccttttggggtgagctgacccagcaccca
aggtatggtcagcagctgcgcctgagccgctatcaaaaggctaagcccacctcagcaggt
ctcgttagctatttttccagtgagcatttcaagggcattgggcaaaaaacagctgagaaa
atcattgccctttacggtaataaccctattgatgacattttaaaaaatcccagtcggctt
aatgagatctctagcctttctaaggctaatcgtgaagcctttgtggcaaagctcaaagcc
aattatggcactgagcaggtgattgctgccttggctgatctaggactggccaatcgcttt
gcctttcagctatttgacaaatacaaggaagaggctgttcatatcgtcaaggacaatcct
tatcaactcattgaggacattcaaggctttggctttaagctggctgatagcttagctgaa
cagctaggaatcgagagtgactctcccaagcgctttcgtgcggctctgctgcattgcctg
ttggagcaatccatcaagcgaggcgacacctatatccaagcacgtgagcttttggcgctg
accattagcctattagaggacacaaggccagtcgaatgcgacccagctattgttgccaat
cagctaacccagctcatcgacgagggcaaggttatgactattggcacgcgtgtttttgac
agcagcctttattatgctgaagaaggcattcaaaagcatctgacacgcttactacagcag
cctctgactaaggagcttagtcaagataccattgaccaagaaatccaagccatacaagag
gagtttgctataacctatgacaagatccaaaagcaggccatcagccaggcactgaccagc
aaggttttcattctaacaggaggcccaggcacaggaaagacaaccgttatcaggggcatt
ttacaggcctatgccagcctacatcagattgacctgaaaaaaaaggatattcccattatc
ctagcagctccaactggtcgagctgctcgtcgtatgaacgaattaaccggtctagcaagc
gcaactattcaccgccatcttgggttaaacggagacaatgattaccaggcaatggaggat
tatttagattgtgatttgctgattgttgatgagttttccatggttgatacctggctggcc
aatcagctgctaacagcgatcagctctaacacccagctgatcatcgtaggagatagcgac
cagctgccttctgtcggtcctggacaggtactagctgacttgctaaaggttgatcggatc
cctcacattacccttgacaagatttttcgccaatcagaggagtcaaccattgttgattta
gccaaccacatacgccaaggcattcttgctcctgatttttgtcagaaaaaggctgatcgc
tcctactttgaagcgcaagcgccattcattcccggcatgatgacaaagatcgtacaggct
gccctaaaaagtggcatcccagctgaggaaattcaaatcctagcccctatgtacaaagga
ctagcaggcatcaacagcctcaaccagctcatgcaaaatctcctgaatcctctagctgat
cagacagaatttctctttaacgagacggcctttcgtaagggagacaaggtgcttcacctt
gtcaatgacgcacagcttaatgtcttcaatggtgatattggctatatcacagacctcatt
ccagccaaatataccgaatccaagcaggacgaaatcgtcatagactttgatggcaccgag
atcgtctacccaagaaatgaatggttaaaaatcacccttgcctatgccatgagcattcac
aaatctcaaggcagtgaatttcaggtggtaatcctgcctgtcacccgtcagagtggtcga
cttctgcagagaaatctcatctacactgccatcaccagatcaaaaagtaagctcatcatg
cttggagaaatagccgcctttgaggaggctatcaaaaaagaaggcgacaagcgacacacc
tatctcgtacaaaggcttcaagctgaggaagctgataaccatatagcagctgcttcagca
aatgaatcaaatcagtctagcttatctgtaaagccagctcctagcccacaaaaggaacaa
gagcagcctccttatctgctcacccctcataatttcctagctatagatcccatgatcggt
ctaaccgaagatgatatgttaaccttttttaagaaaaaatcataa

DBGET integrated database retrieval system