KEGG   Streptococcus equi subsp. zooepidemicus ATCC 35246: SeseC_00709Help
Entry
SeseC_00709       CDS       T02355                                 

Gene name
glk
Definition
glucokinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
sezo  Streptococcus equi subsp. zooepidemicus ATCC 35246
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:sezo00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SeseC_00709 (glk)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SeseC_00709 (glk)
   00052 Galactose metabolism
    SeseC_00709 (glk)
   00500 Starch and sucrose metabolism
    SeseC_00709 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    SeseC_00709 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    SeseC_00709 (glk)
   00524 Butirosin and neomycin biosynthesis
    SeseC_00709 (glk)
Enzymes [BR:sezo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     SeseC_00709 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
589203..590174
Genome map
AA seq 323 aa AA seqDB search
MSQKLIGIDLGGTTIKFGILTSEGDVQEKWAIETNVLEDGKHIVPDIVASLKHRLDLYGL
TKDDFIGIGMGSPGAVDRTDHTVTGAFNLNWRGTQEVGSVIERELGIPFAIDNDANVAAL
GERWVGAGDNNPDVVFMTLGTGVGGGIIADGNLIHGVAGAGGEIGHMVVEPLKGFACTCG
SQGCLETVASATGVVKVARLLAEAYEGDSAIKAAIDNGEAVSSKDIFVAAEAGDAFANSV
VEKVSYYLGLAAANISNILNPDSVVIGGGVSAAGEFLRSRVEKYFMTFTFPQVRQSTKIK
IAELGNDAGIIGAASLARQFITE
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgagtcaaaaattgatagggattgatttgggcggaaccacgattaaatttggtatttta
acctcagagggtgacgttcaggaaaaatgggcgattgagacaaatgttttggaggacggc
aagcatatcgttccagatattgtcgcctcactcaagcatcgccttgacctttacggactg
accaaggacgattttatcggcattggtatgggctcacctggcgctgttgatcgcacagat
catactgttacaggggcctttaacctcaactggagaggtacccaggaggtgggatctgtt
attgaaagggaactaggcattccttttgctattgataatgacgcaaatgtcgcagccctt
ggtgagcgctgggtcggtgcaggtgacaataatcctgatgtggtctttatgaccttggga
acaggtgttggtggtggtattatcgctgatggcaacttgattcatggtgtggctggcgca
ggtggtgagattgggcacatggtagtggagccgcttaagggctttgcctgcacctgtggt
tcacagggctgcttggagacagtggcctctgctacaggtgttgttaaggttgctcgtctg
ttagcagaagcctacgaaggagattcagccatcaaggcagctattgataatggagaagcg
gtctcaagcaaggacatttttgttgcagcagaggctggtgatgcctttgccaactctgtt
gttgaaaaggtcagttattatctaggactggcagcggctaatatctcaaatattttgaac
cctgattcagtcgtgattggtggcggtgtgtccgctgcgggagagtttttacgctcacgt
gttgaaaagtactttatgacttttacctttccgcaggttagacagtccactaagatcaaa
atagcagagcttggtaatgatgctgggatcattggtgcggccagccttgcaagacaattt
atcacagaatag

DBGET integrated database retrieval system