KEGG   Streptococcus equi subsp. zooepidemicus ATCC 35246: SeseC_00774Help
Entry
SeseC_00774       CDS       T02355                                 

Gene name
recR
Definition
(RefSeq) recombination protein RecR
  KO
K06187  
recombination protein RecR
Organism
sezo  Streptococcus equi subsp. zooepidemicus ATCC 35246
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:sezo00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    SeseC_00774 (recR)
DNA repair and recombination proteins [BR:sezo03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      SeseC_00774 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
639014..639610
Genome map
AA seq 198 aa AA seqDB search
MLYPIPIAKLIESYSKLPGIGVKTATRLAFYTIGMSDEDVNDFAKNLLAAKRELTYCSIC
GNLTDDDPCHICTDSSRDKETILVVEASKDVSAMEKIQEYHGYYHVLHGLISPMNGVGPD
DINLKSLITRLMAGEATEVIVATNATADGEATAMYISRILKPAGIKVTRLARGLAVGSDI
EYADEVTLLRAIENRTEL
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
gtgctttaccctataccaatcgcaaaattaattgaaagctattctaaattaccagggatt
ggcgttaaaacagcgacaagattggctttttacaccattggaatgtctgatgaggatgtg
aatgattttgccaaaaatttattagcagctaagcgagaattaacctattgctccatctgt
ggcaatttgacagatgatgatccctgccatatttgcacagatagcagtcgggataaagag
actattttagttgttgaggcttccaaggacgtttctgctatggaaaaaattcaagaatat
catggctattaccatgtgctgcatggcttgatttctcccatgaatggggttggtccagat
gacatcaatctaaagagtctaatcacgcgtttgatggctggagaggcaacggaggtcatt
gttgcaacgaatgccacagcagatggagaggcgactgcgatgtacatttcacgtatccta
aagcctgctggtatcaaggtaacgagattggctagaggcttggcagtaggatcagacatt
gaatatgctgatgaagtgaccctgctacgagcgattgaaaatcgaacagaattatag

DBGET integrated database retrieval system