KEGG   Streptococcus equi subsp. zooepidemicus ATCC 35246: SeseC_00848Help
Entry
SeseC_00848       CDS       T02355                                 

Gene name
nagZ
Definition
glycosyl hydrolase family protein
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
sezo  Streptococcus equi subsp. zooepidemicus ATCC 35246
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:sezo00520]
Human Diseases; Drug resistance; beta-Lactam resistance [PATH:sezo00312]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
703183..704973
Genome map
AA seq 596 aa AA seqDB search
MTHLVDLRKKPYNLDEEAICWVEDTIAAMTLEEKIGQLFVNMGASRSEDYLTQVLEDYHI
AAVRYNKGMASEIWDQNYILQTKSKIPMLIAANTEAGGDGAVNDGTKVGDEIKVAATNDP
KYAYEMGRIAGLEASAVGCNASFAPIVDLTRNWRNPIIANRNWGANVDQIIELSKEYMKG
IMEYGIMPFAKHFPGDGIDERDHHLSFASNPMTKEEWLSSFGRIYGELAEAGLPGIMAGH
IHLPNVEKAMHPERELDDMLPASLNKTLLDELLRGELGYNGAIVTDASHMVAMTASMPRR
LLLPTAIEAGCDLFLFFNDPDEDLQWMKEGYEAGILSDERLHDALRRTLGLKAKLGLHRF
EGHREDIMLPKEEAMALINTPEAQAIADEVADKAITLVKNKQAGIFPVTPERYKRVLIVN
VEGYKGGFGAMIAGQKKRASDIVKDLLEARGHEVTVWESTEERIMQLPEEERAAAIANVY
AQKQPISNITEHYDLILNLVDVNSGGTVQRIIWPAAKGTPDQPFYVHEVPTIVVSVQHAF
ALADMPQVGTYINAYDGKDNTMKALVAKLAGESEFTGVSPVDAFCGLIDTQLWHSF
NT seq 1791 nt NT seq  +upstreamnt  +downstreamnt
atgacacatttagtagatttaagaaaaaaaccatataacctagacgaagaagctatttgc
tgggtggaggataccattgcagcaatgaccttggaggagaagataggtcagctatttgtt
aatatgggggctagtcgatcagaggattatttaacccaggtgcttgaggattatcatatt
gcagctgttcgctacaataaaggcatggcttcagaaatttgggatcaaaattatatttta
caaactaaatccaagattccaatgctcattgctgccaatacagaggctggtggtgatggt
gctgttaatgatggcactaaggttggtgatgaaatcaaggtagctgcgacaaacgatcct
aaatacgcttatgaaatgggacggattgcaggactggaagcgtcagctgttggctgtaat
gcctcctttgcgccaattgttgatttgacgcgtaattggcgtaatcctatcattgctaat
cgcaactggggggcaaatgttgatcaaatcattgagctttccaaagagtacatgaagggg
attatggaatatggtatcatgccctttgccaagcacttccctggtgatggtattgatgag
cgtgaccatcatttgtcctttgcctcaaacccaatgaccaaggaagagtggctatctagc
tttggacgtatttatggcgagcttgcagaggctggcttacctggtattatggcaggacat
attcacctgccaaatgttgaaaaggccatgcaccctgagcgtgagctagatgatatgctt
ccagcctcacttaataaaaccctcttagatgagctgctgcgtggtgagcttggctataat
ggtgctattgtgactgacgcttcgcatatggttgcgatgacagcctcaatgccacgtcgc
ttattgttaccaacagcgattgaggcaggctgcgatctttttttattctttaatgaccca
gatgaagacctacaatggatgaaagagggctatgaggcagggattttaagtgacgaacgc
cttcatgacgcccttcgtcgtacgcttggcttgaaagcaaagcttgggcttcatcgcttt
gaaggacaccgagaagatattatgctgcctaaggaagaggcgatggccttgatcaataca
ccagaggctcaggcgattgctgatgaggttgctgataaggcgataactctggtcaaaaac
aagcaggcagggattttcccggtaactccagagcgctacaagcgtgtgctgattgttaat
gttgagggctacaagggtggctttggggctatgattgcaggacagaaaaaacgggcctca
gatatcgttaaagacttgctagaggcgcgtgggcatgaggtgactgtttgggaatcaact
gaagagcgtatcatgcagctaccagaggaagagcgtgcagcagctattgctaatgtctat
gcacaaaagcagccgatttcaaacattacagagcattatgatttgattcttaatttggta
gatgttaattctggaggtacagttcagcgtattatctggccagctgctaagggcaccccg
gatcagccattctacgtccatgaggtcccaacaatcgttgtttccgttcagcacgccttt
gcccttgctgatatgccacaggttggtacctatatcaacgcttacgatggcaaggacaat
accatgaaggctttagttgcaaaattagctggtgaatctgaattcaccggagtgtctcct
gttgatgccttttgtggcttgattgatactcagctatggcatagcttctga

DBGET integrated database retrieval system