KEGG   Streptococcus equi subsp. zooepidemicus ATCC 35246: SeseC_01393Help
Entry
SeseC_01393       CDS       T02355                                 

Gene name
folK
Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase FolK
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
sezo  Streptococcus equi subsp. zooepidemicus ATCC 35246
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sezo00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    SeseC_01393 (folK)
Enzymes [BR:sezo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     SeseC_01393 (folK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1172198..1172704)
Genome map
AA seq 168 aa AA seqDB search
MTLVYLGLGTNMGDRAGYLQAAVTALSKLPETELLRQSSIYQTAAWGKKDQNDFLNMVCQ
LDTRLTPEALLAATQAIEQDLGRVRHEKWGPRTIDIDLLLFGDEPYQSKALTIPHPYMTQ
RAFVLIPLLEIAPDVTLPDSQKSLRSYLDALEQSDVALWSHEYSNKFS
NT seq 507 nt NT seq  +upstreamnt  +downstreamnt
atgacacttgtttatttaggcttgggaactaatatgggagatagagcaggctacctacag
gcagcagttactgccctatctaagctgccagagactgagttactgagacaatcctctatc
tatcaaacagcagcttggggaaaaaaggatcaaaatgattttttgaatatggtctgtcag
ctagatactaggctgacaccagaagctcttttagcagctacccaggctatcgagcaggat
ctaggacgggttcgccatgaaaaatggggaccaaggacaattgatattgacctcttgctg
tttggtgatgagccttaccagtccaaggccttgacgattcctcacccttacatgacacaa
agagcttttgttttgattcccctattagagattgcacctgatgtgaccttgcctgatagc
cagaaaagcctgaggtcttaccttgatgctttagagcaatcagatgtagccctgtggtca
catgagtattcaaataagttttcttaa

DBGET integrated database retrieval system