KEGG   Streptococcus equi subsp. zooepidemicus ATCC 35246: SeseC_01655Help
Entry
SeseC_01655       CDS       T02355                                 

Gene name
bglB
Definition
beta-glucosidase
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
sezo  Streptococcus equi subsp. zooepidemicus ATCC 35246
Pathway
Glycolysis / Gluconeogenesis
Brite
KEGG Orthology (KO) [BR:sezo00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SeseC_01655 (bglB)
Enzymes [BR:sezo01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     SeseC_01655 (bglB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1391804..1393204)
Genome map
AA seq 466 aa AA seqDB search
MKQSKRRYQFPEGFLWGSSTSGPQSEGTVSGDGKGPSNWDYWFSLEPDKFHHQIGPEVTS
TFYTNYKSDIALLKETGHTAFRTSIQWSRLIPEGVGQVNPKAVAFYREVFQEIMAQDIKL
IVNLYHFDLPYALQEKGGWEAKETVWAYETYAKTCFELFGDLVDTWITFNEPIVPVECGY
LGHYHYPCKVDAKAAVQVAYHTQLASSLAIKACHELYPKHRISIVLNVTPAYPRSDQPED
VKAARIAELFQTKSFLDPSVLGVYPEELVALLEAADLLPQYSADELAIIKNNPVDFLGVN
YYQPLRVQAPNKIRQDGDPITLASYFELYDMPGKKVNPHRGWEIYEQGLYDIAITLKEHY
GNIDWLVTENGMGVEGEEAFLADGQVQDDYRIAFIKDYLIQLHRALEEGANCKGYLLWTF
IDCWSWLNAYKNRYGLVALDLETQKRTLKKSGHWFKTLSQTNGFDK
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atgaagcaatcaaaacgccgttaccaatttccagaaggttttttgtggggaagctcaaca
tctggccctcaaagtgaggggactgtttctggagatgggaagggacctagcaattgggac
tactggtttagtctggagccagataagtttcatcatcagattggtccagaggtaacctca
accttttacaccaactacaaaagcgatattgcccttttgaaagagaccggtcacacagct
tttcggacctctattcaatggtctcgactgattccagaaggggttggtcaggttaatcca
aaagctgtagccttttaccgagaggtatttcaggaaatcatggctcaggacattaagctg
attgttaacctctatcattttgatctgccttatgccttgcaagaaaagggaggctgggag
gctaaggagacggtctgggcttatgagacctatgctaagacctgttttgagctttttggt
gatttggtggatacatggattacctttaacgaacctattgttccagtcgaatgcggttat
ttggggcattaccactatccttgcaaggtagacgccaaggcagctgttcaagtggcttac
catacccagttggctagctcacttgctatcaaggcctgccacgagctgtatcctaagcat
aggattagtattgtgctgaatgtgactcctgcctatcctagaagtgatcagccagaagat
gtcaaggcagcgagaatcgcagagcttttccagactaaatccttcctagatccgtctgtc
ttaggagtgtacccagaagagttagtagctcttttagaggcagctgatttattgccccag
tatagtgctgatgaattggctattatcaaaaacaatcctgttgatttcttgggggttaat
tactatcaacccctgcgtgtgcaagcgcctaataaaataagacaagatggtgatccgatc
acgctagcctcttattttgaactttatgatatgccaggcaaaaaggttaaccctcatcgc
ggttgggaaatatatgagcagggcctttacgacattgctatcactttaaaagagcattat
ggcaatattgactggctagtcactgaaaatggtatgggagtagaaggtgaagaagccttt
ttagctgatggtcaggtccaagacgattatcggattgcctttatcaaggactatttgatt
caattgcatagggctttagaagaaggtgcaaactgtaaaggctacctcctatggaccttt
attgattgctggtcttggttaaatgcctataaaaatcgttatggcttggtagccttggat
ttagagactcaaaaacgaacccttaaaaaatctggccactggtttaagaccctgagtcag
acaaatggttttgataaatag

DBGET integrated database retrieval system