KEGG   Streptococcus equi subsp. zooepidemicus ATCC 35246: SeseC_02235Help
Entry
SeseC_02235       CDS       T02355                                 

Gene name
dug1
Definition
peptidase
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
sezo  Streptococcus equi subsp. zooepidemicus ATCC 35246
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:sezo01230]
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:sezo00300]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1836750..1838120)
Genome map
AA seq 456 aa AA seqDB search
MTKTDQQYLTRLWEDQLTQDYLVSLGQLIASRSIFAQGIGLEETAAYLKELFAQAGAEVI
VDKTYAAPFVLARFNSSRPAAKTLIFYHHYDTVPADNDQKWTSDPFTLTERDGYLFARGV
DDDKGHIIARLTAVVRYLKEHADLPLNIVFMMEGAEESASVDLDRYLAKYADQLKGAELL
IWEQGIRNEHDQLEITGGNKGILTFEMSVDSARCDIHSKYGGVIESAAWYLLQALSSLRN
HRGELLVPGIYQKVVPPTERELDLVETYAIENAQALKKLYGLELPMLQSERRQLLAAYYF
QPSINIQGLWTGYQGQGVKTIIPSQATAKLEVRLVPGLEPEYVFDQIRSYLLNKGFDQIK
LTYTLGEMSYRSDLSSSAIRQLVAVAEPLYPKGLSLLPTSAGTGPMHTVFEALQVPIAAF
GLGHSNSRDHAGDENIAIIDYCRHIALIEELITSYE
NT seq 1371 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaaacggatcagcagtacttaacaaggctttgggaggatcagctcacacaggat
tatcttgtgtcgttggggcaattgattgccagtaggtctatttttgctcaaggtatcggc
ttagaagagacagcagcctatctaaaggagctgtttgctcaggctggtgctgaggttatt
gttgataagacttatgcagctccctttgtcctagcacgttttaatagctctaggccagct
gctaagacactgattttttatcatcattacgatacagtgccagcagataatgatcaaaaa
tggacaagcgatccctttaccttaacagagcgtgatggctatttgtttgcgcgcggcgtt
gatgatgacaaggggcatatcattgcgagattgacggctgtcgtcaggtatctaaaggag
catgctgaccttccgcttaatattgtctttatgatggagggagctgaggagtcagcttcg
gtagatttagatcggtatctggctaaatacgcagaccagctaaagggagcagagcttttg
atttgggagcagggcattcgtaatgagcatgatcagcttgaaataactggcggcaataag
gggattttgacctttgagatgtcagtagatagtgctcgttgtgatattcattctaaatat
ggtggtgttatcgagtcagcagcctggtatttgcttcaggccctatcaagcctgcggaat
catcgcggggaattgctggtgcctggtatttatcaaaaagtcgttccgccaactgagcga
gagctagatttagttgagacctatgcaattgagaatgctcaagctctaaaaaagctttac
ggactggagcttcctatgttacaatcagagcgtcgtcaattgttagcagcttattacttt
cagccctccattaacattcaagggctgtggactggctatcaaggacaaggagttaagacc
atcattccttcacaggctactgctaaactggaggttcgtttggttcctggcttagagcct
gagtatgtctttgatcagattaggtcttatttgctcaataagggctttgaccagatcaag
ctgacctataccttgggtgagatgagctaccgcagtgatctttcatcgtctgctattcgt
cagcttgttgcagtggctgagccgctttatcctaaggggctatctcttttgccgacatcg
gcaggaacaggccctatgcatactgtttttgaagccctgcaggttccgattgctgccttt
ggcttaggacattctaatagtcgtgatcatgcaggtgatgaaaacattgctattatagat
tattgtcggcatattgcattaatagaggagttaataacatcttatgagtga

DBGET integrated database retrieval system