KEGG   Streptomyces pratensis: Sfla_0076Help
Entry
Sfla_0076         CDS       T01647                                 

Definition
alpha-galactosidase
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
sfa  Streptomyces pratensis
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:sfa00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Sfla_0076
  Lipid metabolism
   00561 Glycerolipid metabolism
    Sfla_0076
   00600 Sphingolipid metabolism
    Sfla_0076
Enzymes [BR:sfa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     Sfla_0076
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
80763..82922
Genome map
AA seq 719 aa AA seqDB search
MPHIEIDRPSGTVLLRASDTSYVLRVDTAAGTVRTLHWGASLSLDDARALLEPDPATDSF
RSPLDGTEELAVDGQVRFAPPALDVRYGDGTSAVEPVVDGYDVRRDGDSSELSVRLRDHG
RPLAWTLHYRVRQDCPVIERWTVFRHTGPGPTEPGEEPALSLVRHSAAQWNLPVLPAYRM
SSVHGQWAGEFQLRRTPLAVGETTVSSRRGHTGHQSNPWLALDAGDATEETGEVWTVALA
TAGSWRMTAVRSAEGRCGVLGGSGHEGVEITLAPGASWTTPVSTGLYAPGGFGGASRAYH
SYVRRYVLPAPDEPRPVLYNSWEATAFDVTFDGQRELADLAARVGAELFVVDDGWFGARD
SDRAGLGDWTPRPGAFPDGLRPLADHVHGLGMRFGLWVEPEMVNPDSDLFRAHPEWVLHL
PDRTAHTLRNQLVLDFSRPEVTDWALTWLLRTVDAFAVDFLKWDFNRSFTEAGSSGRHPD
ARRVFVGHALGAHEVMDRLRAARPALRIETCSGGGGRVDLASLARTDQAWTSDNTDAVDR
LSIQYGFSQLYPAQVMGAWVTDSPNPITLRTVPLRFRLHSAMAGALGIGGDLTRWPEAEL
DETAAYVALYKTVRSTVQTGRQYRLGSPADSYHAVQYVARDSDESVVFQWRAGPEERAVL
PRLRLRGLVPEAVYRVDDDSEITRAGTVRSGAALMAHGLSAQLPQGGYASRMLTLRREG
NT seq 2160 nt NT seq  +upstreamnt  +downstreamnt
atgccccacatcgagatcgaccgcccgtcggggaccgtgctgctccgcgcctccgacacc
agctacgtcctgcgggtcgacacggcggccgggaccgtgcgcacgctccactggggggcc
tccctctccctcgacgacgcccgcgcgctgctggagccggaccccgctacggacagtttc
cgcagccccctggacggcacggaggaactggcggtcgacggacaggtgcggttcgccccg
cccgcactcgatgtgcggtacggggacgggaccagcgcggtcgagcccgtcgtggacggc
tacgacgtccggcgggacggcgacagctcggagctgtccgtcaggctccgcgaccacggc
cgcccgctcgcgtggacgctgcactaccgcgtccggcaggactgcccggtgatcgaacgc
tggaccgtgttccggcacacgggccccgggccgacggagcccggcgaggagccggcgctc
tcgctcgtacggcattcggccgcccagtggaatctgccggtcctgcccgcgtaccggatg
agttccgtgcacgggcagtgggcgggcgagttccagctgcggcggaccccgctcgccgta
ggcgagacgacggtcagcagccggcgtggtcacacgggtcaccagagcaacccctggctc
gccctcgacgccggggacgccaccgaggagacgggcgaggtctggacggtcgccctcgcc
accgcgggaagctggcggatgacggcggtgcggtccgcggagggccggtgcggggtgctg
ggcggcagcggtcacgagggcgtggagatcaccctcgcgcccggcgcgagctggaccact
cccgtgagcaccggcctgtacgcgccaggggggttcggcggagcgtcccgggcgtaccac
tcctacgtacggcgatacgtgctgcccgcccccgacgaaccacgccccgtgctctacaac
tcctgggaggcgacggccttcgacgtcaccttcgacgggcagcgggaactggcggacctg
gccgcgcgcgtcggggccgagctgttcgtggtcgacgacggatggttcggggcccgcgac
agcgaccgcgcgggtctcggcgactggacccctcggccgggcgccttccccgacggactg
cgcccgctcgccgaccacgtccacgggctgggcatgcggttcgggctgtgggtggagccg
gagatggtcaatcccgacagcgatctgttccgcgcgcacccggagtgggtgctgcacctg
cccgaccgcaccgcccacaccctgcgcaaccagctggtgctcgacttctcgcggcccgag
gtgacggactgggcgctcacctggctgctgcgcaccgtcgacgcgttcgctgtggacttc
ctcaagtgggacttcaaccggtcgttcacggaggcgggttcctccggtcgccacccagac
gcacgcagggtgttcgtcgggcacgccctcggggcgcacgaggtcatggaccggctgcgg
gccgcgcggccggcgctgcggatcgagacctgctcgggcggcggcggacgcgtcgacctg
gcgagcctggcccgcaccgatcaggcgtggacgtcggacaacacggacgcggtcgaccgg
ctgagcatccagtacggcttctcgcagctctatcccgcgcaggtgatgggcgcctgggtg
acggacagcccgaacccgatcaccctgcggaccgtgcccctccgcttccgcctgcacagc
gcgatggccggggcgctcggtatcggcggcgacctgacgcgctggccggaggcggaactg
gacgagacggcggcgtacgtagccctgtacaagacggtgcggtccaccgtccagaccggc
cggcagtacaggctgggctcgccggcggacagttaccacgccgtgcagtacgtggcgcgc
gacagcgacgagtccgtggtcttccagtggcgggccgggcccgaggaacgcgcggtgttg
ccccgcctgcggctgcgcggccttgttcccgaggccgtgtaccgcgtcgacgacgacagc
gagatcacacgtgcgggcaccgtgcgcagcggtgccgcgctgatggcgcacggactgtcg
gctcagctcccgcaggggggttacgcgagcaggatgctgacgctgcgccgggaagggtga

  All links  
No link information was found.   
DBGET integrated database retrieval system