KEGG   Streptomyces pratensis: Sfla_0227Help
Entry
Sfla_0227         CDS       T01647                                 

Definition
(GenBank) Enoyl-CoA hydratase/isomerase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
sfa  Streptomyces pratensis
Pathway
sfa00071  Fatty acid degradation
sfa00280  Valine, leucine and isoleucine degradation
sfa00281  Geraniol degradation
sfa00310  Lysine degradation
sfa00360  Phenylalanine metabolism
sfa00362  Benzoate degradation
sfa00380  Tryptophan metabolism
sfa00410  beta-Alanine metabolism
sfa00627  Aminobenzoate degradation
sfa00640  Propanoate metabolism
sfa00650  Butanoate metabolism
sfa00903  Limonene and pinene degradation
sfa00930  Caprolactam degradation
sfa01100  Metabolic pathways
sfa01110  Biosynthesis of secondary metabolites
sfa01120  Microbial metabolism in diverse environments
sfa01130  Biosynthesis of antibiotics
sfa01212  Fatty acid metabolism
Module
sfa_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:sfa00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Sfla_0227
   00650 Butanoate metabolism
    Sfla_0227
  Lipid metabolism
   00071 Fatty acid degradation
    Sfla_0227
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Sfla_0227
   00310 Lysine degradation
    Sfla_0227
   00360 Phenylalanine metabolism
    Sfla_0227
   00380 Tryptophan metabolism
    Sfla_0227
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Sfla_0227
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Sfla_0227
   00281 Geraniol degradation
    Sfla_0227
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Sfla_0227
   00627 Aminobenzoate degradation
    Sfla_0227
   00930 Caprolactam degradation
    Sfla_0227
Enzymes [BR:sfa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Sfla_0227
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_2 ECH_1 TrbM HTH_32
Motif
Other DBs
NCBI-ProteinID: ADW01695
UniProt: E8W3J8
Position
complement(276060..277118)
Genome map
AA seq 352 aa AA seqDB search
MNDDEPVLLHTEGHILHLTLNRPRALNALTHTMVRGIDEALVRAADDDAVTAVVIDGAGG
RGLCAGGDIRSIYEDARAGRSASVDFWRDEYRLNARIARFPKPYVALMDGIVMGGGVGVS
AHGDVRVVTERSRVAMPETAIGFVPDVGGTHLLAAAPGELGTHLALTGRTVGAADAVLCG
LADHFVPSQHLADLVTELARSATPTEVQETVRRYATTAPEGELAAQRTWIDECYAADTVE
EIIDRLSNSGVTAAKETAAALLTASPTALKVTLAAVRRAARLGSLEAVLDQEFRVSCRAF
TGHDLTEGVRARIIDKDRTPRWSPAEIHEVTAAEVARHFEPLGDRELGLFTS
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atgaacgatgacgagcccgtcctgctgcacaccgagggtcacatcctccacctcaccctc
aaccggccgcgggccctgaacgcactgacccacaccatggtgcgcggcatcgacgaagcg
ctcgtccgggccgcggacgacgacgcggtcaccgccgtcgtgatcgacggagccggcggt
cgaggactctgcgcgggcggcgacatccgctcgatctacgaggacgcccgcgcgggccgc
agcgcctccgtggacttctggcgcgacgagtaccggctcaacgcccgcatcgcccgcttc
cccaagccgtacgtggcgctcatggatggcatcgtgatgggcggcggggtaggcgtgtcg
gcccacggcgacgtgcgcgtcgtcaccgagcgttcacgtgtcgcgatgcccgagacggcg
atcggcttcgtacccgacgtgggcggcacccatctgctggccgcggccccgggggagctc
ggcacccacctcgcgctcaccggccggacggtcggcgccgccgacgccgtcctgtgcggg
ctggccgaccacttcgtcccgtcgcagcacctcgccgacctcgtcaccgagctggcacgg
agtgcgacacccaccgaggtgcaggagaccgtgcggcggtacgcgaccaccgcacccgaa
ggggaactggccgcgcagcgcacatggatcgacgaatgctacgccgccgacaccgtcgag
gagatcatcgaccggctgtccaacagcggtgtgacggccgcgaaggagacggccgccgcg
ctgctcaccgcctcacccacggcgctcaaggtcacgctggccgccgtacgccgggccgcg
cggctcggcagtctcgaagccgtcctcgaccaggagttccgcgtctcctgccgggccttc
accggacatgacctcacggagggcgtacgcgcacggatcatcgacaaggaccgcacaccg
cggtggagcccggcggagatccatgaggtgaccgctgctgaggtcgcccggcacttcgag
ccgctcggggaccgggaactgggcctgttcacgagctga

DBGET integrated database retrieval system