KEGG   Streptomyces pratensis: Sfla_0326Help
Entry
Sfla_0326         CDS       T01647                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
sfa  Streptomyces pratensis
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sfa00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    Sfla_0326
Enzymes [BR:sfa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     Sfla_0326
Exosome [BR:sfa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Sfla_0326
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
378871..380388
Genome map
AA seq 505 aa AA seqDB search
MADFIGAVDQGTTSTRFMIFDHGGNEVAKHQLEHAQILPRSGWVEHDPVEIWERTNSVMQ
NALRFGGIAPGDLAAIGITNQRETTVIWDPRNGRPYYNAIVWQDTRTDAIAAELERSGRG
DVIRRKAGLPPATYFSAGKIQWILENVDGVREAAEAGHAIFGNTDAWVLWNLTGGPDGGI
HATDVTNASRTMLMDLETLDWDEELLSFFNIPRSMLPTINPSSHAEAYGTTRTSRPLRAA
VPIGGVLGDQQAATVGQVCFSPGEAKNTYGTGNFLVLNTGTELVRSQHGLLTTVAYQFGD
SPVVYALEGSIAVTGSAVQWLRDQMKIIKTAAESEVLARSVDDNGGMYFVPAFSGLFAPY
WRSDARGAIVGLARYNDNAHLARATLESICYQSRDVVEAMEQDSGVHLDVLKVDGGVTAN
DLCMQIQADVLGVPVSRPVVAETTALGAAYAAGLATGFWQNTDELRAQWHESERWAPQWS
EEQREEGYAGWKKAVERTLDWVKVS
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atggcggacttcatcggcgcggtggatcaggggaccaccagcacacgattcatgatcttc
gaccatggcggcaacgaggtcgccaagcaccaactggagcacgcccagatcctgccgcgt
tcgggctgggtggaacacgacccggtggagatctgggagcgcacgaactccgtgatgcag
aacgccctgaggttcgggggcatcgcgccgggtgacctggcggcgatcggcatcaccaac
cagcgtgagacaacggtgatctgggacccgcgcaacgggcgcccctactacaacgccatc
gtgtggcaggacacccgtacggacgccatcgccgccgagctcgaacggtcgggccggggc
gacgtcatccgccggaaggcgggactcccgccggcgacctacttctccgcaggcaagatc
cagtggatcctggagaacgtcgacggcgtacgggaagccgccgaggccggtcacgcgatc
ttcggcaacacggacgcctgggtcctgtggaatctgaccggcggccccgacggcggcatc
cacgccaccgacgtgaccaacgccagccgcaccatgctgatggacctggagaccctcgac
tgggacgaggagctgctgagcttcttcaacatcccccggtcgatgctgcccaccatcaac
ccctcctcccatgcggaggcctacggaacgacccgcacctcacggccgttgcgcgcggcc
gtccccatcggcggggtcctcggcgaccagcaggccgccaccgtcgggcaggtctgcttc
tcacccggcgaggccaagaacacctacgggaccggcaacttcctggtcctcaacacgggt
acggaacttgtccgttcccagcacgggctgctcaccacggtggcataccagttcggcgac
agcccggtggtctacgcgctggagggctccatcgccgtgaccggttccgccgtgcagtgg
ctgcgggaccagatgaagatcatcaagaccgcggcggagagcgaggtgctggcccggtcg
gtcgacgacaacggcggcatgtacttcgtccccgcgttctcgggcctgttcgccccctac
tggcgctccgacgcacgcggcgcgatcgtcgggctcgccaggtacaacgacaacgcccac
ctggcgcgggcgaccctggagtccatctgctaccagagccgtgacgtcgtcgaagccatg
gagcaggattccggcgtccacctcgacgtgctcaaggtggacggcggcgtcaccgccaac
gatctctgcatgcagatccaggcggacgtcctcggtgtcccggtcagccgcccggtcgtc
gcggagaccaccgcgctcggcgcggcctatgcggcggggctggcgacgggcttctggcag
aacaccgacgaactgcgcgcccagtggcacgagtccgagcggtgggctccgcagtggtcc
gaggagcagcgcgaggaaggctacgcgggctggaagaaggccgtggaacgcaccctcgac
tgggtgaaggtctcctag

DBGET integrated database retrieval system