KEGG   Streptomyces pratensis: Sfla_0508Help
Entry
Sfla_0508         CDS       T01647                                 

Definition
molecular chaperone GroES
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
sfa  Streptomyces pratensis
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:sfa00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Sfla_0508
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Sfla_0508
  Lipid metabolism
   00071 Fatty acid degradation
    Sfla_0508
  Amino acid metabolism
   00350 Tyrosine metabolism
    Sfla_0508
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Sfla_0508
   00626 Naphthalene degradation
    Sfla_0508
Enzymes [BR:sfa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Sfla_0508
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(590092..591132)
Genome map
AA seq 346 aa AA seqDB search
MKAVQYRTVGAAPEVVEIPEPVAGPGQILLKVTAAGVCHSDIAVMSWPAEGFPYELPLTL
GHEGVGTVAALGEGAVGVSVGDSVAVYGPWGCGTCVNCAEGRENYCLRAADLGINPPGLG
NPGAMAEYMIVDDARHLTPIGDLDPVKTVSLTDAGLTPYHAIKRSLPKLLPGATAVVIGT
GGLGHVAIQLLRAMTAVRVVALDVTEEKLSLARAVGAHEAVLSDENAAAKVRELTGGIGA
KVVFDFVGAEPTVKAAGAMASVDSDVTIVGIGGGLLPVGFGVLPFSTSVTAPYWGSRKEL
AEVIELAHAGAVDVHVETYSIDEAPLAYERLHAGKINGRAVILPNG
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgaaagccgtccagtaccgcaccgtgggtgccgcgcccgaggtcgtcgagataccggag
cccgtggccggacccggtcagatcctgctgaaggtcaccgccgcgggtgtctgccactcg
gacatcgccgtgatgagctggcccgccgaggggttcccctacgaactcccgctcaccctc
ggccacgagggcgtcggcacggtcgccgcgctcggcgagggcgccgtgggcgtctccgtc
ggcgactcggtcgccgtctacggcccgtggggctgcggtacctgcgtgaactgcgcggaa
ggccgcgagaactactgcctgcgggcggccgacctcggcatcaacccgcccggactcggc
aacccgggtgcgatggccgagtacatgatcgtcgacgacgcccgtcatctgacgccgatc
ggcgacctggacccggtcaagacggtctcgctgaccgacgcgggcctcacgccgtaccac
gcgatcaagcgctcgctgccgaaactcctgcccggcgccaccgccgtggtcatcggcacc
ggaggcctcggccacgtcgccatccagctcctgcgcgccatgaccgccgtccgggtcgtc
gcgctcgacgtcaccgaggagaagctgtccctcgcgcgtgcggtcggcgcccacgaggcc
gtgctgtccgacgagaacgccgccgccaaggtccgcgaactcaccggcggcatcggtgcc
aaggtcgtcttcgacttcgtcggtgccgagccgaccgtgaaggcggccggcgcgatggcc
tccgtcgacagcgacgtcaccatcgtcggcatcggcggcggactgctgcccgtcggattc
ggggtcctgccgttctccacctcggtcaccgcgccgtactggggctcgcgcaaggagctc
gccgaggtcatcgaactggcccacgcgggagccgtcgacgtgcacgtcgagacgtactcc
atcgacgaggccccgctcgcctacgaacggctccacgcgggcaagatcaacggccgcgcg
gtcatcctgcccaacggctga

DBGET integrated database retrieval system