KEGG   Streptomyces pratensis: Sfla_0556Help
Entry
Sfla_0556         CDS       T01647                                 

Definition
asparagine synthase
Orthology
K12674  
(carboxyethyl)arginine beta-lactam-synthase [EC:6.3.3.4]
Organism
sfa  Streptomyces pratensis
Pathway
Clavulanic acid biosynthesis
Biosynthesis of secondary metabolites
Module
Clavaminate biosynthesis, arginine + glyceraldehyde-3P => clavaminate
Brite
KEGG Orthology (KO) [BR:sfa00001]
 Metabolism
  Biosynthesis of other secondary metabolites
   00331 Clavulanic acid biosynthesis
    Sfla_0556
Enzymes [BR:sfa01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.3  Cyclo-ligases
    6.3.3.4  (carboxyethyl)arginine beta-lactam-synthase
     Sfla_0556
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
644715..646244
Genome map
AA seq 509 aa AA seqDB search
MAHTLPAATGFLVSARKGGGQAPGPVFATRGAHESVAEALRNQTFDAVLVHSGSPGDAVA
RAGDTALVLAGELYNREELLTLLPSGGDVRTDAQLVLALLGIYDLHAFRLLNGRFAAAAA
LGDRLLLATDHAGSVPLYTLPAPGRVLAATEIKALVPATAGTPPAGRPVADARRVRRVPG
VHQVPAGTVLDLDVRTGTAVPHRTWAPALSRRVRSEADATDAVRRTLERAVEARTGGTTP
LVVLSGGIDSSGVAALAAAHTDGPLDTLSMGTDTANEFAEARVVATHLGSAHREITVPTA
DLLGQLPYAIWASESVDPDIIEYLLPLTALYRALDGPARRILTGYGADIPLAGMHREDRL
PQLDTAVAFDMATFDGLNEMTPVLSGIQGHWSTHPYWDRDVLDLLVPLEAGLKRRYGRDK
WVLREAMSALLPQETVTRPKLGVHEGSGTTSSFSLLLMDAGVPDADVHRAKSLVVREIFD
RVVVEGLPPAEVRTADAVHQVAARLKETE
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
atggcacacacactccccgcggccacggggttcctggtctccgcccgaaagggcgggggc
caggcccctgggcccgtgttcgccacccggggcgcccacgaatccgtggccgaggccctc
cgcaaccagaccttcgacgccgtgctcgtccactcgggttcgcccggggacgccgtggcc
cgcgccggtgacacggcgctcgtcctggccggcgagctctacaacagggaggagctgctc
accctcctcccgtccggcggcgacgtccgcacggacgcgcagctcgtgctcgctctcctg
ggcatctacgacctgcacgcgttccggctgctcaacggccggttcgcggcggccgccgcc
ctcggtgaccggctgctcctggccaccgaccacgcgggttccgtcccgctctacaccctt
ccggcgccggggcgcgtcctcgccgccaccgagatcaaggccctcgtcccggcgacggcg
gggacgccgcccgccgggcggcccgtcgccgacgcgcgccgtgtgcgccgcgtaccgggg
gtccaccaggtgcccgccggcacggtcctggacctggacgtccgtacgggcaccgccgtg
ccccaccggacctgggctcccgctctgtcacggcgtgtgcggtccgaggccgacgccacc
gacgcggtgcgcaggactctggagcgggcggtcgaggcgcgcacgggtggcaccacgcca
ctggtggtgctctccgggggaatcgattcttcaggagtcgccgcgctcgccgccgcccac
acggacggccccctggacaccctgtccatggggaccgacaccgcgaacgagttcgccgag
gcccgcgtggtcgcgacccacctcggctccgcgcaccgggagatcaccgtcccgaccgcg
gacctgctcggtcagctgccctacgcgatctgggcgtccgagtccgtcgacccggacatc
atcgagtacctgctgccgctcaccgccctgtaccgggcgctcgacggtccggcccgccgg
atcctcaccggctacggggccgacatcccgctcgccgggatgcaccgcgaggaccggctg
ccccagctggacaccgccgtggcgttcgacatggccacgttcgacgggctcaacgagatg
actccggtgctctccggcatccagggccactggtcgacgcacccgtactgggaccgcgac
gtactggacctgcttgtgcccctggaggccgggctcaaacgccgctacggccgcgacaag
tgggtcctgcgcgaggcgatgagcgccctgctcccgcaggagaccgtcaccaggccgaag
ctcggcgtgcacgagggctccgggacgacgtcctccttcagcctgctgctgatggatgcc
ggggtgccggacgccgacgtccacagggccaagtccctggtggtgcgggagatcttcgac
cgggtggtcgtcgaaggactgccgcccgccgaggtgcgcaccgccgacgcggtccaccag
gtggccgcacgcctgaaggagaccgagtga

DBGET integrated database retrieval system