KEGG   Streptomyces pratensis: Sfla_0557Help
Entry
Sfla_0557         CDS       T01647                                 

Definition
agmatinase
Orthology
K12676  
proclavaminate amidinohydrolase [EC:3.5.3.22]
Organism
sfa  Streptomyces pratensis
Pathway
Clavulanic acid biosynthesis
Biosynthesis of secondary metabolites
Module
Clavaminate biosynthesis, arginine + glyceraldehyde-3P => clavaminate
Brite
KEGG Orthology (KO) [BR:sfa00001]
 Metabolism
  Biosynthesis of other secondary metabolites
   00331 Clavulanic acid biosynthesis
    Sfla_0557
Enzymes [BR:sfa01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.22  proclavaminate amidinohydrolase
     Sfla_0557
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
646288..647238
Genome map
AA seq 316 aa AA seqDB search
MERVDTTISPRYAQIPTFMRLPHDPNPSGRDVVVIGAPYDGGTSYRPGARFGPRAIRNES
GLIHGVGIDRGPGTFELIDCVDGGDIDLTPFNMHIAMETAHRHLRDLLQDNAAFLMLGGD
HSLTLAALRAVAEQHGPVAVVHLDAHSDTNPAFYGGEFHHGTPFRHGIDEGLIDPARTVQ
IGIRGHNPRPDSLDYARGKGVRVVTTDEFVETGVAGTHALIQELIGDRPVYVSVDVDVAD
PAFAPGTGTPAPGGLSSREVLALLRCVGELRPVGFDVMEVSPLYDHAGITSVLATEIGAE
LLYQYARAHIKGRNDA
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
gtggaacgtgtcgacaccacgatctcgccccgttacgcgcagatccccaccttcatgcgt
ctgccgcacgacccgaaccccagcggacgcgacgtcgtggtcatcggtgccccctacgac
ggcggcacgagctaccggccgggtgcccgtttcggcccccgtgccatccgcaacgagtcc
ggactgatccacggggtcggcatcgaccgggggcccggcaccttcgaactcatcgactgc
gtggacggcggggacatcgacctcaccccgttcaacatgcacatcgccatggagacggcc
caccgccatctgcgcgacctcctccaggacaacgccgccttcctgatgctcggcggcgac
cactcgctcaccctggccgccctgcgtgccgtggccgagcagcacgggcccgtcgccgtg
gtccacctggacgcgcactccgacaccaaccccgctttctacggcggtgagttccaccac
gggactcccttccggcacgggatcgacgaaggcctcatcgaccccgcccgcacggtgcag
atcggaatcaggggccacaacccccggcccgactcgctggactacgcgcggggcaaaggg
gtgcgtgtcgtcacgacggacgagttcgtggagaccggtgtcgccgggacccacgcactc
atccaggagctcatcggcgaccgccccgtctacgtgtcggtcgacgtcgacgtcgccgac
ccggccttcgccccgggcaccggcacccccgcgcccggcgggctctcctcccgcgaggtg
ctggccctgctgcgctgcgtgggtgagctgcgtccggtcggtttcgacgtcatggaggtc
tcgcccctctacgaccacgccgggatcacctccgtcctggcgaccgagataggcgcggag
ctgctctaccagtacgcccgcgctcacatcaaaggaaggaacgacgcgtga

DBGET integrated database retrieval system