KEGG   Streptomyces flavogriseus: Sfla_0557Help
Entry
Sfla_0557         CDS       T01647                                 

Definition
agmatinase
Orthology
K12676  
proclavaminate amidinohydrolase [EC:3.5.3.22]
Organism
sfa  Streptomyces flavogriseus
Pathway
Clavulanic acid biosynthesis
Biosynthesis of secondary metabolites
Class
Metabolism; Biosynthesis of other secondary metabolites; Clavulanic acid biosynthesis [PATH:sfa00331]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
646288..647238
Genome map
AA seq 316 aa AA seqDB search
MERVDTTISPRYAQIPTFMRLPHDPNPSGRDVVVIGAPYDGGTSYRPGARFGPRAIRNES
GLIHGVGIDRGPGTFELIDCVDGGDIDLTPFNMHIAMETAHRHLRDLLQDNAAFLMLGGD
HSLTLAALRAVAEQHGPVAVVHLDAHSDTNPAFYGGEFHHGTPFRHGIDEGLIDPARTVQ
IGIRGHNPRPDSLDYARGKGVRVVTTDEFVETGVAGTHALIQELIGDRPVYVSVDVDVAD
PAFAPGTGTPAPGGLSSREVLALLRCVGELRPVGFDVMEVSPLYDHAGITSVLATEIGAE
LLYQYARAHIKGRNDA
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
gtggaacgtgtcgacaccacgatctcgccccgttacgcgcagatccccaccttcatgcgt
ctgccgcacgacccgaaccccagcggacgcgacgtcgtggtcatcggtgccccctacgac
ggcggcacgagctaccggccgggtgcccgtttcggcccccgtgccatccgcaacgagtcc
ggactgatccacggggtcggcatcgaccgggggcccggcaccttcgaactcatcgactgc
gtggacggcggggacatcgacctcaccccgttcaacatgcacatcgccatggagacggcc
caccgccatctgcgcgacctcctccaggacaacgccgccttcctgatgctcggcggcgac
cactcgctcaccctggccgccctgcgtgccgtggccgagcagcacgggcccgtcgccgtg
gtccacctggacgcgcactccgacaccaaccccgctttctacggcggtgagttccaccac
gggactcccttccggcacgggatcgacgaaggcctcatcgaccccgcccgcacggtgcag
atcggaatcaggggccacaacccccggcccgactcgctggactacgcgcggggcaaaggg
gtgcgtgtcgtcacgacggacgagttcgtggagaccggtgtcgccgggacccacgcactc
atccaggagctcatcggcgaccgccccgtctacgtgtcggtcgacgtcgacgtcgccgac
ccggccttcgccccgggcaccggcacccccgcgcccggcgggctctcctcccgcgaggtg
ctggccctgctgcgctgcgtgggtgagctgcgtccggtcggtttcgacgtcatggaggtc
tcgcccctctacgaccacgccgggatcacctccgtcctggcgaccgagataggcgcggag
ctgctctaccagtacgcccgcgctcacatcaaaggaaggaacgacgcgtga

DBGET integrated database retrieval system