KEGG   Streptomyces pratensis: Sfla_0769Help
Entry
Sfla_0769         CDS       T01647                                 

Definition
beta-galactosidase
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
sfa  Streptomyces pratensis
Pathway
Galactose metabolism
Brite
KEGG Orthology (KO) [BR:sfa00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Sfla_0769
Enzymes [BR:sfa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     Sfla_0769
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
893083..895059
Genome map
AA seq 658 aa AA seqDB search
MPSLHDAARGRILFGGDYNPEQWPEEVWADDVRLMEEAGVNSVTVGVFSWAMIEPRPGAR
EFGWLDRLLDLLAAHGIGAVLATPTSSPPPWMGALHPETLPRTEDGALVNYGSRQHFCPS
SPVYRRYAAALTEDLAARYADHPALTVWHINNEYCTHCWCDETAGHFRRWLGSRYTTLDA
LNDAWGTAFWSQRYDTWAEILPPRRAQYMRNPAQELDFKRFTSDALMECYTAERDIVARH
TPHIPVTTNFMPLWSGQDAWAWAEQEDIVSVDVYPDPTDPHGGQYNAMLADMTRSQARGP
WMVMEQAAGPVNWRDVNHPKPAGLNRLWSLQAVARGADALCYFQWRQSRQGAEKFHSGML
SHAGEEGRTFREVRRIGAELALIGAEVSGTEVTADVAVLHDWDAWWSSTQQGRPSSLVSY
TELVQTWHRGLWESGISTEFARPGGDLSAYRMVLVPQLQLLGDAAVDNLVAYVRGGGTLV
CGFFTGVVDTDDRIRPGGMDARLRELFGIRTVHEWWPLDAGATVGCDGFDGTLWSEELEP
DGSAETVAAYRGGELDGLPAVLRKGTAWYVSTLPGPEALRGLLGRVAADAGVRPVLEGLP
PGVEAVRRGALLFLLNHGRSPAAVELPGRYVDLLTGEAADGGVELERYGVAVLGDVRA
NT seq 1977 nt NT seq  +upstreamnt  +downstreamnt
atgccgtccctgcacgacgccgcccgtggccgcatccttttcggaggcgactacaacccc
gagcagtggcccgaggaggtgtgggccgacgacgtccggctgatggaggaggccggggtc
aactccgtcaccgtcggcgtcttctcctgggcgatgatcgaaccgcgtcccggggcgcgg
gagttcggctggctggaccggcttctggacctcctggccgcccacgggatcggagccgtg
ctcgccacgcccacctcgtcccctcccccgtggatgggcgccctgcatccggagacgctg
ccgcgcaccgaggacggcgcactggtcaactacggttcccggcagcatttctgcccgagc
tcgccggtctaccggcgctatgcggccgcgctcaccgaggacctggcggcacggtacgcg
gaccatccggcgctcaccgtgtggcacatcaacaacgagtactgcacgcactgctggtgc
gacgagaccgccggtcacttccgccgctggctgggctcccgctacaccaccctggacgcg
ctgaacgacgcgtggggcacggcgttctggagccagcgctacgacacgtgggcggagatc
ctgccgccgcgccgggcgcagtacatgcgcaaccccgcgcaggagctggacttcaagcgg
ttcacctcggacgccctgatggagtgctacaccgccgagcgggacatcgtcgcccggcac
accccgcacatcccggtgacgaccaacttcatgccgctgtggtcgggccaggacgcctgg
gcctgggcggagcaggaggacatcgtctccgtcgacgtctacccggatcccacggacccg
cacggcgggcagtacaacgcgatgctcgccgacatgacccgttcccaggcacgcggaccg
tggatggtgatggagcaggccgcggggccggtgaactggcgcgacgtcaaccaccccaag
ccggcgggcctcaaccggctgtggtcgctgcaggccgtggccaggggcgcggacgccctc
tgctacttccagtggcggcagtcccggcagggtgccgagaagttccactccgggatgctg
agccacgcgggtgaggaagggcgcaccttccgggaggtcaggcgcatcggtgccgaactc
gccctcatcggcgccgaggtcagtggtaccgaggtgaccgccgacgtcgccgtgctccac
gactgggacgcctggtggtcgagtacccagcagggcaggccgtcctccctcgtctcgtac
acggagctcgtgcagacctggcaccgggggctgtgggagagcgggatcagcacggagttc
gcccgccccggcggcgacctgagcgcctaccgcatggtgctcgtgccccagctccagctc
ctcggcgacgccgccgtcgacaacctcgtcgcgtacgtccggggaggcggcaccctggtg
tgcgggttcttcaccggagtcgtggacacggacgaccggatcaggccgggcggcatggac
gccaggctgcgtgagctgttcggcatccgcacggtgcacgagtggtggccgctggacgcg
ggggcgaccgtggggtgcgacggcttcgacggcaccctgtggtcggaggagctggagccc
gacggcagcgcggagaccgtggccgcgtaccgagggggtgagctggacgggcttccggcg
gtcctccgcaaggggaccgcctggtacgtctcgacgctccccggacccgaggccctgcgc
ggtctgctcggccgggtggcggccgacgccggtgtgcgccccgtcctggagggactgccc
ccgggcgtggaggcggtccggcgcggcgcgctgctgttcctgctgaaccacggccggtcc
cccgccgcggtggagctgccgggccgctacgtcgacctgctcacgggcgaagccgccgac
gggggcgtggagctggagcgctacggggtggccgtgctcggagacgtccgcgcatga

DBGET integrated database retrieval system