KEGG   Streptomyces pratensis: Sfla_0826Help
Entry
Sfla_0826         CDS       T01647                                 

Definition
PfkB domain-containing protein
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
sfa  Streptomyces pratensis
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:sfa00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Sfla_0826
Enzymes [BR:sfa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     Sfla_0826
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(951986..952933)
Genome map
AA seq 315 aa AA seqDB search
MYGNEDSSPSAPSAPSRYDLLVVGSANADLVVGVERRPGPGETVLGTDLVVHPGGKGANQ
AVAAARLGARTALLARVGDDAHGRLLRASQQEAGVDTGGLLVGGAPTGVALITVDPSGDN
SIVVSPGANARLTPDDVRAAGPLFASARVVSVQLEIPLDTVAETARALGPGARLVLNPSP
PAPLPDEVLAACDPLVVNEHEARSILGDGAGDTPEAWARGLTALGPRSVVITLGAEGALV
SDSRTGEAVRVPSPRVAALDTTGAGDAFTAALAWRLGLGEELTEAAAFAVRVGAAAVTKE
GAQASFPTAEEVSAL
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atgtacggaaacgaagactcctcgccctccgctccctccgcgccttcccggtacgacctc
ctggtcgtcgggtcggccaacgcggacctggtcgtgggtgtcgaacggcgccccggaccg
ggcgagacggtgctcggcaccgacctcgtcgtccaccccggcggcaagggcgccaaccag
gcggtcgccgccgcccgcctcggagcccggacggctctgctggcacgggtcggcgacgac
gcccacggccgactgctgcgcgcttcgcagcaggaggccggtgtcgacacgggcggactc
ctcgtcggcggtgcgcccaccggtgtcgccctcatcaccgtcgacccctcgggggacaac
agcatcgtggtgtccccgggcgccaacgcgcggctgacccccgacgacgtcagggccgcg
ggcccgctgttcgcctcggcccgcgtcgtctccgtacagctggagatccccctcgacacc
gtcgcggagacggcccgcgcgctcggtccgggcgcgcggctggtcctcaacccgtccccg
cccgccccgctccccgacgaggtgctggccgcgtgcgaccccctcgtggtcaacgagcac
gaggcgcgctccatcctgggggacggcgcgggggacaccccggaggcctgggcgcgcgga
ctcaccgccctcggaccgcgttcggtggtgatcaccctcggcgcggagggcgcactcgtg
tccgacagccgtaccggggaagccgtacgggtaccgagcccccgggtcgccgccctggac
accacgggagcgggcgacgcgttcaccgccgcgctcgcctggcgcctcggcctgggcgag
gaactcaccgaggccgcggcgttcgccgtgcgggtcggcgcggcggccgtcaccaaggag
ggcgcgcaggcgtccttccccaccgcggaagaggtctcggcactgtga

DBGET integrated database retrieval system