KEGG   Streptomyces pratensis: Sfla_1012Help
Entry
Sfla_1012         CDS       T01647                                 

Definition
ROK family glucokinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
sfa  Streptomyces pratensis
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:sfa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Sfla_1012
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Sfla_1012
   00052 Galactose metabolism
    Sfla_1012
   00500 Starch and sucrose metabolism
    Sfla_1012
   00520 Amino sugar and nucleotide sugar metabolism
    Sfla_1012
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Sfla_1012
   00524 Butirosin and neomycin biosynthesis
    Sfla_1012
Enzymes [BR:sfa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Sfla_1012
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1205880..1207046)
Genome map
AA seq 388 aa AA seqDB search
MSTYRDFTHRGSARATVLRTVGTRERRSHLTAPRVPTVGIDIGGTKVMAGVVDADGNILE
TLRTETPDKSKSPKVVEDTIVELVLDLSDRHDVHAVGIGAAGWVDADRSKVLFAPHLAWR
DEPLRDAIASRLVVPVMVDNDANTAAWAEWRFGAGRGEDHLVMITLGTGIGGAILEDGHV
KRGKYGVAGEFGHMQVVPGGHRCPCGNRGCWEQYSSGNALVREARELAAADSPVAHGLIE
RVKGNIPEITGPLITELAREGDAMCVELLQDIGQWLGVGIANLAAALDPSCFVIGGGVSA
ADDLLIGPARDAFKRHLTGRGYRPEARIAKAQLGPEAGMVGAADLARLVARRFRRTNRRR
VERYERYAQFYDQAATTIRNTRGTRSAE
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgagcacgtaccgcgacttcacacaccgcggctccgcccgcgccaccgtcctgcggacc
gtcggcaccagggagcggcgctcgcacctcacggcgccccgggtgcccacggtcggcatc
gacatcggcggcaccaaggtgatggccggtgtcgtggacgccgacggcaacatcctggag
accctgcgcaccgagacgccggacaagtcgaagagcccgaaggtcgtcgaggacaccatc
gtcgagctggtcctggacctctccgaccgccacgacgtgcacgccgtcggcatcggcgcg
gcgggctgggtggacgcggaccgctccaaggtgctgttcgccccgcacctggcctggcgc
gacgagcccctccgcgacgccatcgcctcccggctggtggtccccgtgatggtcgacaac
gacgccaatacggccgcctgggcggaatggcgcttcggcgccggccggggtgaggaccac
ctggtcatgatcacgctgggcacgggcatcggcggcgcgatcctggaggacgggcacgtc
aagcgcggcaagtacggcgtcgcgggtgagttcggccatatgcaggtggtgcccggcggg
caccgctgcccgtgcggcaaccgcggctgctgggagcagtacagctcgggcaacgccctc
gtgcgcgaggccagggagctggccgcggcggactccccggtggcccacggcctcatcgag
cgggtcaagggcaacatccccgagatcaccgggccgctcatcaccgagctggcccgcgag
ggtgacgccatgtgcgtcgagctcctccaggacatcggacagtggctcggcgtcggcatc
gccaatctcgcggcggcgctggacccgtcctgcttcgtcatcggcggcggtgtcagcgcg
gccgacgacctgctgatcggtcccgccagggacgccttcaagcgccacctcacgggccgc
ggctaccgccccgaggcccggatcgccaaggcgcagctcggacccgaggcgggtatggtc
ggcgccgccgacctcgcccgtctggtcgcccggaggttccggcgtaccaaccggcgcagg
gtcgagcgctacgagcggtacgcgcagttctacgaccaggccgccaccaccatccggaac
acgcgcggaacgcgcagcgccgagtga

DBGET integrated database retrieval system