KEGG   Streptomyces pratensis: Sfla_1012Help
Entry
Sfla_1012         CDS       T01647                                 

Definition
(GenBank) glucokinase, ROK family
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
sfa  Streptomyces pratensis
Pathway
sfa00010  Glycolysis / Gluconeogenesis
sfa00052  Galactose metabolism
sfa00500  Starch and sucrose metabolism
sfa00520  Amino sugar and nucleotide sugar metabolism
sfa00521  Streptomycin biosynthesis
sfa01100  Metabolic pathways
sfa01110  Biosynthesis of secondary metabolites
sfa01120  Microbial metabolism in diverse environments
sfa01130  Biosynthesis of antibiotics
sfa01200  Carbon metabolism
Module
sfa_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:sfa00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Sfla_1012
   00052 Galactose metabolism
    Sfla_1012
   00500 Starch and sucrose metabolism
    Sfla_1012
   00520 Amino sugar and nucleotide sugar metabolism
    Sfla_1012
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Sfla_1012
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    Sfla_1012
Enzymes [BR:sfa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Sfla_1012
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK FGGY_N BcrAD_BadFG Glucokinase
Motif
Other DBs
NCBI-ProteinID: ADW02468
UniProt: E8WER8
Position
complement(1205880..1207046)
Genome map
AA seq 388 aa AA seqDB search
MSTYRDFTHRGSARATVLRTVGTRERRSHLTAPRVPTVGIDIGGTKVMAGVVDADGNILE
TLRTETPDKSKSPKVVEDTIVELVLDLSDRHDVHAVGIGAAGWVDADRSKVLFAPHLAWR
DEPLRDAIASRLVVPVMVDNDANTAAWAEWRFGAGRGEDHLVMITLGTGIGGAILEDGHV
KRGKYGVAGEFGHMQVVPGGHRCPCGNRGCWEQYSSGNALVREARELAAADSPVAHGLIE
RVKGNIPEITGPLITELAREGDAMCVELLQDIGQWLGVGIANLAAALDPSCFVIGGGVSA
ADDLLIGPARDAFKRHLTGRGYRPEARIAKAQLGPEAGMVGAADLARLVARRFRRTNRRR
VERYERYAQFYDQAATTIRNTRGTRSAE
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgagcacgtaccgcgacttcacacaccgcggctccgcccgcgccaccgtcctgcggacc
gtcggcaccagggagcggcgctcgcacctcacggcgccccgggtgcccacggtcggcatc
gacatcggcggcaccaaggtgatggccggtgtcgtggacgccgacggcaacatcctggag
accctgcgcaccgagacgccggacaagtcgaagagcccgaaggtcgtcgaggacaccatc
gtcgagctggtcctggacctctccgaccgccacgacgtgcacgccgtcggcatcggcgcg
gcgggctgggtggacgcggaccgctccaaggtgctgttcgccccgcacctggcctggcgc
gacgagcccctccgcgacgccatcgcctcccggctggtggtccccgtgatggtcgacaac
gacgccaatacggccgcctgggcggaatggcgcttcggcgccggccggggtgaggaccac
ctggtcatgatcacgctgggcacgggcatcggcggcgcgatcctggaggacgggcacgtc
aagcgcggcaagtacggcgtcgcgggtgagttcggccatatgcaggtggtgcccggcggg
caccgctgcccgtgcggcaaccgcggctgctgggagcagtacagctcgggcaacgccctc
gtgcgcgaggccagggagctggccgcggcggactccccggtggcccacggcctcatcgag
cgggtcaagggcaacatccccgagatcaccgggccgctcatcaccgagctggcccgcgag
ggtgacgccatgtgcgtcgagctcctccaggacatcggacagtggctcggcgtcggcatc
gccaatctcgcggcggcgctggacccgtcctgcttcgtcatcggcggcggtgtcagcgcg
gccgacgacctgctgatcggtcccgccagggacgccttcaagcgccacctcacgggccgc
ggctaccgccccgaggcccggatcgccaaggcgcagctcggacccgaggcgggtatggtc
ggcgccgccgacctcgcccgtctggtcgcccggaggttccggcgtaccaaccggcgcagg
gtcgagcgctacgagcggtacgcgcagttctacgaccaggccgccaccaccatccggaac
acgcgcggaacgcgcagcgccgagtga

DBGET integrated database retrieval system