KEGG   Streptomyces pratensis: Sfla_1036Help
Entry
Sfla_1036         CDS       T01647                                 

Definition
malate synthase A
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
sfa  Streptomyces pratensis
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:sfa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Sfla_1036
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Sfla_1036
   00630 Glyoxylate and dicarboxylate metabolism
    Sfla_1036
Enzymes [BR:sfa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Sfla_1036
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1227626..1229245
Genome map
AA seq 539 aa AA seqDB search
MSAPAPSPLAIVDAEPLPRQDEVLTDAALAFVAELHRRFTPRRDELLARRGERRAEIART
STLDFLPETEAVRVDDTWKVAPAPAALDDRRVEITGPTDRKMTVNALNSGARVWLADFED
ASAPTWENVVTGQLNLIDAYTRNIDFTDPRSGKSYALKPAEELATVVTRPRGWHLDERHL
QLDGTPVPGALVDFGLYFFHNAQRLIDLGKGPYFYLPKTESYLEARLWNDIFVFAQDYVG
IPQGTVRATVLIETITAAYEMEEILYELRDHASGLNAGRWDYLFSIVKNFRDGGSKFVLP
DRNLVTMTAPFMRAYTELLVRTCHKRGAHAIGGMAAFIPSRRDAEVNKVAFEKVKADKDR
EAGDGFDGSWVAHPDLVPIAMASFDAVLGAKPNQKDRLREDVSVAAGDLIAIDTLDAKPS
YDGLRNAVAVGIRYIEAWLRGMGAVAIFNLMEDAATAEISRSQIWQWINADVVFENGEHA
TSDLARKVAAEELAAIRAEVGDETFEAGKWQQAHDLLLQVSLDQDYADFLTLPAYEQLG
NT seq 1620 nt NT seq  +upstreamnt  +downstreamnt
atgtccgcaccagcgccgtccccgctggccatcgtcgatgccgagcccctgccgaggcag
gacgaggtcctgaccgatgcggccctcgcgttcgtggccgagctgcaccggcggttcacg
ccccggcgcgacgagctgctcgcccgccgtggcgaacgccgcgccgagatcgcccgcacc
tccacgctggacttcctgccggagacggaagcggtccgcgtggacgacacctggaaggtc
gccccggccccggctgcgctggacgaccgccgggtggagatcacgggcccgaccgaccgc
aagatgaccgtcaacgccctgaactcgggagccagggtctggctcgccgacttcgaggac
gcgtccgcccccacgtgggagaacgtcgtcaccggccagctcaacctcatcgacgcctac
acccggaacatcgacttcaccgacccgaggtcgggcaagtcctacgcgctgaagcccgcc
gaggagctcgcgaccgtcgtcacgcgtccgcgcggctggcacctcgacgagcggcacctc
cagctcgacggcaccccggtgcccggcgccctggtcgacttcggcctctacttcttccac
aacgcgcagcggctgatcgacctcggcaagggcccgtacttctacctgccgaagacggag
tcgtacctggaggcccgcctctggaacgacatcttcgtcttcgcccaggactacgtcggc
atcccgcagggcaccgtccgcgcgaccgtcctgatcgagacgatcaccgccgcgtacgag
atggaggagatcctctacgagctccgcgaccacgcctccgggctgaacgccggccgctgg
gactacctcttctccatcgtgaagaacttccgtgacggcggctcgaagttcgtcctgccg
gaccgcaacctggtgacgatgaccgccccgttcatgcgggcgtacaccgaactcctcgtc
cgcacctgccacaagcgcggcgcgcacgccatcggcggcatggcggccttcatcccctcg
cggcgcgacgccgaggtcaacaaggtggccttcgagaaggtcaaggcggacaaggaccgc
gaggccggcgacggcttcgacggctcctgggtggcccacccggacctggtgccgatcgcg
atggcgtccttcgacgcggtcctgggcgcgaagccgaaccagaaggaccgcctgcgcgag
gacgtctcggtggcggcgggcgacctgatcgccatcgacaccctggacgcgaagccctcg
tacgacgggctgcgcaacgccgtcgccgtcggcatccgctacatcgaggcgtggctgcgg
ggcatgggcgcggtcgccatcttcaacctgatggaggacgcggccaccgccgagatctcg
cgctcgcagatctggcagtggatcaacgcggacgtggtcttcgagaacggcgagcacgcc
acctcggacctcgcccgcaaggtcgccgccgaggaactggccgcgatccgcgcggaggtc
ggcgacgagaccttcgaggccggcaagtggcagcaggcccacgacctgctgctccaggtc
tcgctggaccaggactacgcggacttcctgacgctgccggcgtacgagcagctgggctga

DBGET integrated database retrieval system