KEGG   Streptomyces pratensis: Sfla_1052Help
Entry
Sfla_1052         CDS       T01647                                 

Definition
urate oxidase
Orthology
K00365  
urate oxidase [EC:1.7.3.3]
Organism
sfa  Streptomyces pratensis
Pathway
Purine metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Module
Purine degradation, xanthine => urea
Brite
KEGG Orthology (KO) [BR:sfa00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Sfla_1052
  Biosynthesis of other secondary metabolites
   00232 Caffeine metabolism
    Sfla_1052
Enzymes [BR:sfa01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.3  With oxygen as acceptor
    1.7.3.3  factor-independent urate hydroxylase
     Sfla_1052
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1247813..1248745)
Genome map
AA seq 310 aa AA seqDB search
MPTILGQNQYGKAENRVVRITRDGDTHHIKDLNVSVALSGDMDDVHYSGSNANVLPTDTT
KNTVYAFAKEHGIESAEQFGIHLARHFVTSQEPIEVARIRIEEYAWERIATSDGNSKFIG
ADEVKHSFVRKGQETRTTQITFDGEKWEVISGLKDLTVMNSTNSEFWGYVKDRYTTLKEA
YDRILATDVSARWRYNWTGDEQRMPNWEKSYEQARKHMLQAFAETYSLSLQQTLYQMGSR
IINSRSEIDEIRFSLPNNHHFLVDLEPFGLENDTADGAVYFAADRPYGLIEATVLRDGVE
PKIPVDMTNL
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atgcccacgattctcggccagaaccagtacggcaaagcagagaaccgcgtcgtcaggatc
acgcgggacggcgacacccaccacatcaaggacctcaacgtctcggtcgccctctccggc
gacatggacgacgtccactactcgggctccaacgccaacgtcctgccgaccgacaccacc
aagaacacggtgtacgccttcgccaaggaacacggcatagagtccgccgagcagttcggc
atccacctggcccggcacttcgtgacctcgcaggagccgatcgaggtggcgcgcatcagg
atcgaggagtacgcctgggagcgcatcgcgacctccgacggcaactcgaagttcatcggc
gccgacgaggtcaagcactccttcgtccgcaagggccaggagacgcgcaccacacagatc
accttcgacggtgagaagtgggaggtcatctcgggcctcaaggacctcacggtgatgaac
tccaccaactccgagttctggggctacgtcaaggacaggtacacgacgctgaaggaggcg
tacgaccgcatcctcgcgaccgacgtctccgcccggtggcgctacaactggaccggcgac
gaacagcgcatgcccaactgggagaagtcctacgagcaggcgcgcaagcacatgctccag
gccttcgctgagacctactccctctcgctccagcagaccctctaccagatgggttcgcgc
atcatcaacagccgcagcgagatcgacgagatccgcttctccctgccgaacaaccaccac
ttcctggtggacctcgaaccgttcggcctggagaacgacacggccgacggtgccgtgtac
ttcgcggcggaccgcccgtacggcctcatcgaggcgacggtgctccgggacggcgtcgag
ccgaagatcccggtcgacatgaccaacctctga

DBGET integrated database retrieval system