KEGG   Streptomyces pratensis: Sfla_1210Help
Entry
Sfla_1210         CDS       T01647                                 

Definition
protoporphyrinogen oxidase
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
sfa  Streptomyces pratensis
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Heme biosynthesis, glutamate => protoheme/siroheme
Brite
KEGG Orthology (KO) [BR:sfa00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Sfla_1210
Enzymes [BR:sfa01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     Sfla_1210
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1418479..1419966)
Genome map
AA seq 495 aa AA seqDB search
MQRPLQRDTTRPGHAVVVGGGIAGLAAAHRLSASGIRVTLLEATARLGGKLMTGEIAGTR
VDLGAESMLARRPEAVALATDVGLGGRLQPPATATASVWTRDALRPMPKGHVMGVPGDPA
ALGGVLSPEGLARIAEERDLTPTAVGDDVAVGSYVADRLGREVVDRLVEPLLGGVYAGDA
YRISMRAAVPQLFEAVKEGGPLLDGVLRIQERAAARQQTGPVFQGIEGGIGTLPGAVADA
VRAAGGEILDETPVLGLTRTGQGWDVRTDSRVIAADAVVLATPAWSASTLLAAECPAASV
ELAAVEYASMALVTMAFRRSDIADTEALHGRSGFLVPPVDGRTIKAATFSSNKWQWVADA
APDLFVLRTSVGRYGEEEHLHREDSELVAASLGDLATAAGLTARPVDTEVTRWIGGLPQY
PVGHLGRVSRIRDEVAKLPSLRVCGAVYDGVGIPACVASAHRAADEIVQDLTAPAAGEID
NTPTRVRGTGSEAGQ
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atgcagcgtcctcttcagcgcgacaccacacgcccgggccatgccgtcgtcgtcggcggg
ggcatcgccggactcgccgccgcccaccggctgtcggcctccggtatccgggtcaccctc
ctggaggcgaccgcgcggctcggcggcaagctgatgaccggcgagatcgccggcacccgg
gtcgacctgggtgcggagtccatgctcgcgcgccggcccgaagcggtcgcactcgccacc
gacgtggggctcgggggccgtctccagccgcccgccacggccaccgcgtcggtgtggacc
cgcgacgccctgcgccccatgcccaaggggcatgtgatgggggtcccgggcgacccggcg
gcgctcggcggggtgctctcgcccgagggcctggccaggatcgccgaggaacgcgacctg
accccgaccgccgtcggcgacgacgtggcggtcggcagttacgtcgcggaccggctcggc
cgcgaggtcgtcgaccggctcgtggaaccgctgctcggcggggtctacgccggggacgcc
taccggatctcgatgcgcgcggccgtcccccagctcttcgaagccgtcaaggagggggga
ccgctcctcgacggcgtactccgcatccaggagagggccgccgcacggcagcagaccggg
ccggtcttccagggcatcgaggggggcatcggcaccctgcccggcgccgtggccgacgcc
gtgcgcgccgcgggcggtgagatcctcgacgagaccccggtcctcggcctgacccggacc
ggccagggctgggacgtgcgcaccgacagccgggtgatcgcggccgacgccgtcgtcctg
gccactcccgcctggtccgcgtccaccctgctcgccgccgagtgcccggccgcgtccgtc
gagctcgccgccgtcgagtacgcctcgatggccctggtgaccatggccttccggcgttcc
gacatcgcggacaccgaggcgctccacgggcgttcgggcttcctcgtgccgcccgtcgac
gggcgcaccatcaaggccgccaccttctccagcaacaagtggcagtgggtcgccgacgcg
gcccccgacctcttcgtgctgcgcacctccgtgggccgctacggcgaggaggagcacctg
caccgcgaggactccgaactggtcgccgcgtccctgggcgatctcgccacggcggccggg
ctgaccgcccggcccgtggacaccgaggtcacgcggtggatcggcggtctcccgcagtac
cccgtggggcacctcggccgggtctcccggatccgggacgaggtggcgaaactgccgagt
ctgcgggtgtgcggagcggtgtacgacggcgtggggatcccggcctgcgtggcgagcgcg
caccgtgccgccgacgagatcgtccaggacctgacggccccggcggcgggggagatcgac
aacaccccgacccgggttcggggcacggggagcgaggcgggacaatag

  All links  
No link information was found.   
DBGET integrated database retrieval system