KEGG   Streptomyces pratensis: Sfla_1244Help
Entry
Sfla_1244         CDS       T01647                                 

Definition
xylose isomerase
Orthology
K01805  
xylose isomerase [EC:5.3.1.5]
Organism
sfa  Streptomyces pratensis
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sfa00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Sfla_1244
   00051 Fructose and mannose metabolism
    Sfla_1244
Enzymes [BR:sfa01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.5  xylose isomerase
     Sfla_1244
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1463162..1464331
Genome map
AA seq 389 aa AA seqDB search
MTDRFTPTPADRFTFGLWTVGWRGNDPFGDATRPVLDPVESVERLAELGAHGVTFHDDDL
IPFGSDGKERARLVGRFKDALERTGMKVPMATTNLFTHPVFKDGGFTSNDRDVRRFALRK
VIRNIDLAAELGASTYVAWGGREGAESGGAKDVRLALDRMKEAFDLLGDYVTEQGYDLRF
AIEPKPNEPRGDILLPTIGHALAFIERLERPEMVGVNPETGHEQMAGLNFPHGIAQALWA
GKLFHIDLNGQSGIKYDQDFRFGAGDLRQAFWLVDLLESAGYDGSLHFDFKPVRTDGIDG
VWESAKNCMRNYLILKERAAAFRADPAVQEALTASRLHELARPTADDGLKALLADTSAYE
NFDATAAAERSMAFEALDQLAMEHLLGVR
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgacggaccgcttcactcccactcccgcggacaggttcacgttcggtctgtggacggtg
ggctggcgtggcaacgacccgttcggtgacgcgacgcgtccggtgctggatccggtggag
tcggtggagcggctcgcggagctgggggcgcacggtgtgacgttccatgacgacgacctg
atcccgttcgggtcggacgggaaggagcgggcccggctggtcgggcggttcaaggacgcg
ttggagcggaccgggatgaaggtcccgatggcgacgacgaacctgttcacgcacccggtg
ttcaaggacggcgggttcacctcgaacgaccgtgacgtgcggcgtttcgcgctgcgcaag
gtgatccggaacatcgatctggccgccgagctgggtgcgtccacgtatgtggcctggggc
gggcgtgagggtgcggagtccgggggtgccaaggacgtgcggctggcgctggaccggatg
aaggaggccttcgacctgctgggcgactacgtcaccgagcagggctacgacctgcggttc
gcgatcgagcccaagcccaacgagccccgcggcgacatcctgctgcccacgatcggtcac
gcgctggcgttcatcgagcgtctggagcgccccgagatggtcggggtgaacccggagacc
gggcacgagcagatggccgggctgaacttcccgcacggcatcgcgcaggcgctgtgggcc
ggcaagctcttccacatcgacctcaacggccagtccggcatcaagtacgaccaggacttc
cgtttcggcgccggggacctgcgccaggcgttctggctcgtcgacctgctggagagcgcc
ggctacgacggatcgctgcacttcgacttcaagcccgtgcgcaccgacggcatcgacggg
gtctgggagtccgcgaagaactgcatgcgcaactacctcatcctcaaggagcgcgccgcc
gcgttccgcgcggaccccgccgtccaggaggccctgaccgcctcccgcctccacgagctc
gcccgccccaccgccgacgacggcctcaaggccctcctcgccgacacctccgcctacgag
aacttcgacgccaccgccgccgcggaacgctccatggccttcgaagccctcgaccagctc
gccatggaacacctcctcggcgtccgctga

DBGET integrated database retrieval system