KEGG   Streptomyces pratensis: Sfla_1653Help
Entry
Sfla_1653         CDS       T01647                                 

Definition
1-deoxy-D-xylulose 5-phosphate reductoisomerase
Orthology
K00099  
1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
sfa  Streptomyces pratensis
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:sfa00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Sfla_1653
Enzymes [BR:sfa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     Sfla_1653
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2025809..2027071)
Genome map
AA seq 420 aa AA seqDB search
MGSMSDSPAPLADPHLVFDAAEGRRDLVILGSTGSIGTQAIDLVLRNPGRFRVTALSAAG
GRVRLLAEQARQLRVRTVAVADGDKVPALREALREVFGQGEPLPEILAGPDAATDLAGSD
CHTVLNGITGSIGLAPTLAALKAGRTLALANKESLIVGGPLVKALAAPGQIIPVDSEHAA
LFQALAAGKRADVRKLVVTASGGPFRGRTRAELADVTREQALAHPTWAMGPVITVNSATL
VNKGLEVIEAHLLYDIPFDRIDVVVHPQSYVHSMVEFTDGSTLAQATPPDMGGPIAIGLG
WPERVPDAAPAFDWTKASSWEFFPLDTEAFPSVGLARHVGTLGGTAPAVFNAANEECVDA
FLAGRLPFNGIMDTVTSVVAEHGTPATGTSLTVADVLEAETWARSRARELSAAATAEAHA
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
atggggtccatgagcgacagccccgcacccctcgccgatccgcatctcgtcttcgacgcc
gccgaaggccgccgcgatctggtgatcctcggctccaccgggtccatcggcacccaggcc
atcgacctggtcctgcgcaaccccggccgtttccgcgtcaccgcgctctccgccgcgggc
ggcagggtccggctcctggccgagcaggcgcggcagctgcgcgtccgcacggtcgcggtc
gccgacggggacaaggtgcctgcgctccgcgaggcgctgcgcgaggtcttcgggcagggc
gagccgctccccgagatcctggccggtcccgacgccgccacggatctcgcgggcagcgac
tgccacaccgtgctgaacgggatcaccggctcgatcggcctcgcccccacgctcgccgcg
ctgaaggcgggccgcaccctcgccctggccaacaaggagtcgctgatcgtcggcggcccc
ctggtcaaggcgctggcggcccccggccagatcatcccggtcgactccgagcacgccgcg
ctcttccaggcgctcgccgcgggcaagcgcgccgacgtgcgcaagctcgtcgtgaccgcg
tccggcggcccgttccgcgggcggacgcgcgccgagctggccgacgtcacccgcgagcag
gccctggcacacccgacctgggccatgggaccggtcatcacggtcaactccgcgaccctg
gtcaacaagggcctggaggtcatcgaggcgcatctgctctacgacatccccttcgaccgg
atcgacgtcgtggtccacccccagtcgtacgttcactcgatggtggagttcaccgacggc
tcgaccctcgcccaggcgaccccgcccgacatgggcggccccatcgccatcggtctcggc
tggcccgagcgggtcccggacgcggcccccgcgttcgactggacgaaggcctccagctgg
gagttcttcccgctcgacaccgaggcgttcccgtccgtcgggctcgcccggcacgtgggc
accctcggcggcaccgcgcccgcggtcttcaacgcggccaacgaggagtgtgtcgacgcc
ttcctcgcgggacggctgccgttcaacggaatcatggatacggtcacatccgtggtggcc
gaacacggcacccccgccacgggaacttcactgacggtcgcggacgtcctcgaagcggag
acctgggcccgttccagggctcgcgaactctcggcggcagcgacagcggaggcgcacgca
tga

  All links  
No link information was found.   
DBGET integrated database retrieval system