KEGG   Streptomyces flavogriseus: Sfla_1774Help
Entry
Sfla_1774         CDS       T01647                                 

Definition
glycoside hydrolase 5
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
sfa  Streptomyces flavogriseus
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:sfa00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2157554..2158930
Genome map
AA seq 458 aa AA seqDB search
MKRLFALLAAFATVLGLMGAFGPQAVAANGCKVEYTVASQWQGGFQAGVKVTNLGAPVSG
WTLRFTMPDAGQRVAQGWNATWSQSGSAVSAVAVDWNRTLATGAAADLGFSGTLTGANPK
PTAFTLNGVACTGSVDEPTPDPDPVAGTPVEVNGQLHVCGVNLCNQYNRPVQLRGMSTHG
IQWFDQCYGAASLDALANDWKSDLLRISMYVQEDGYETDPAGFTNRVNALVDMAEARGMY
ALIDFHTLTPGDPNYNLARAKTFFAAVAARNAGKKNVIYEITNEPNGVSWSAVKSYAEQV
IPVVRAADPDGVVVVGTRGWSSLGVSDGSDENEVVNNPVNATNLMYAFHFYAASHKDSYR
STLSRAASRLPLFVTEFGTVSATGGGAMDVASTTAWLNLLDQLKISYANWTYSDAPESSA
AFRPGTCGGGDYSSSGVLTESGALLKARISTPDSFPTS
NT seq 1377 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgcctgttcgccttactggcggccttcgcgaccgtcctgggcctgatgggggcg
ttcggcccccaggccgtggccgccaacggctgcaaggtcgagtacacggtcgccagccag
tggcagggcggcttccaggccggagtgaaggtcaccaatctgggagcccccgtcagcgga
tggacgctccgcttcaccatgccggacgccgggcagagggtcgcccagggctggaacgcc
acctggtcgcagtccggttcggcggtcagcgccgtcgctgtcgactggaaccgcacgctg
gccacgggcgcggcggccgacctgggcttctccggcaccctcacgggcgccaacccgaag
cccacggcgttcaccctcaacggcgtcgcctgcacaggctccgtcgacgagcccaccccc
gaccccgaccccgtcgccggcactcctgtggaggtcaacggtcaactccacgtctgcggc
gtgaacctgtgcaaccagtacaaccgccccgtgcagctgcggggcatgagcacgcacggc
atccagtggttcgaccagtgctacggcgccgcgtccctggacgcgctggcgaacgactgg
aagtcggacctgctgcgcatctccatgtacgtacaggaggacggctacgagaccgacccg
gcgggcttcaccaaccgtgtgaacgcgctcgtcgacatggccgaggcccgcggcatgtac
gcgttgatcgacttccacaccctgacgccgggcgacccgaactacaacctcgcccgcgcc
aagacgttcttcgcggccgtcgccgcccgcaacgccggcaagaagaacgtgatctacgag
atcaccaacgagcccaacggcgtgagctggtcggccgtcaagagctacgccgagcaggtc
atcccggtcgtccgggccgccgacccggacggcgtcgtcgtcgtcggcacgcgcggctgg
tcctcgctgggcgtgtcggacggctccgacgagaacgaggtcgtgaacaaccccgtcaac
gccaccaacctcatgtacgcgttccacttctacgccgcgagccacaaggactcctaccgc
tccacactgagccgggcggcctcgcggctcccgctcttcgtgacggagttcggcacggtg
agcgccaccggcggcggcgcgatggacgtggcgagcaccacggcctggctgaacctgctc
gaccagttgaagatcagctacgcgaactggacctactccgacgctcccgagagcagcgcc
gcgttccgccccggtacgtgcggcggcggcgactacagcagcagcggcgtgctcacggag
tccggggcactgctgaaggcccgcatcagtacgcccgacagcttccccaccagctga

DBGET integrated database retrieval system