KEGG   Streptomyces pratensis: Sfla_1811Help
Entry
Sfla_1811         CDS       T01647                                 

Definition
glycoside hydrolase 30
Orthology
K01201  
glucosylceramidase [EC:3.2.1.45]
Organism
sfa  Streptomyces pratensis
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sfa00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    Sfla_1811
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Sfla_1811
Enzymes [BR:sfa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     Sfla_1811
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2205372..2207240
Genome map
AA seq 622 aa AA seqDB search
MIRTSRTASVLVATALATAGLAGLSPGTAQAAGETVNIVLTTTDDSGGRHVTRGLQAQTP
VAFGAGNGGSGTNITVDENTRYQTFTGGGASFTDTAAWLMKGSGALSQATRDATMKKLFS
PTEGIGLSFVRNPMGGSDLARFGYTYDDMPAGQTDPNLANFSIAHDLQDVLPLTKQAEQL
NPALTTVASPWTAPAWMKDNGQLNGGWLKAENYGAYANYFVKYLQAWRDQGVPVDYVTAQ
NEPTCCSGYPSMSWNGSGLAYFTKSELLPKLRSAGLATKVLAHDWNWDSYDAYAAPTVDD
PAVRDHPNFGGVAWHGYGGDVAKQTAVHDRYPQLDAFQTEHSGGTWIADQQREDMLNIID
YTRNWAKSVTKWSLAVDQNRGPHNGGCGTCDGLVTVHNGDSRHGQVDYTIEYYTMGHLTK
YVRPGAARIASTGSSAVPNVAWRNPDGSKALIAYNGSASAQQVTVNWGGQKFTYSLPGRT
SATFTWSGTQSGSSGSTGALTGNGGKCLDATGHSGSDGTPVQIWDCTGAANQKWTVSGDG
SVKVLGACLDVTSGSTADGAKVQLYTCNGSGAQRWTYDSSTGDLVNTAADKCLDVADRST
ADGARVQIWTCTGAANQKWRLR
NT seq 1869 nt NT seq  +upstreamnt  +downstreamnt
atgatccggacaagcagaacggcgagcgtcctcgtcgccacggcgctcgcgaccgcggga
ctggccgggctctccccgggcaccgcgcaggccgccggtgagaccgtgaacatcgtgctg
accaccacggacgactccggcggccgtcacgtcacccgcggcctccaggcccagacgccg
gtcgccttcggtgccgggaacggcggctcgggcacgaacatcaccgtcgacgagaacacc
cgctaccagaccttcaccggaggcggcgcctcgttcacggacacggcggcctggctgatg
aagggcagcggggccctgagccaggccacccgcgacgcgacgatgaagaagctcttctca
ccgacggagggcatcggattgtccttcgtacgcaatccgatgggcggatcggacctcgcg
cgattcggttacacctacgacgacatgcccgccgggcagacggacccgaatctcgcgaac
ttctcgatcgcacatgatctccaggacgtcctgccgctcacgaagcaggccgagcagctc
aaccccgcgctgacgacggtggcctccccgtggacggcaccggcctggatgaaggacaac
gggcagctgaacggcggctggctgaaggccgagaactacggcgcctacgcgaactacttc
gtgaagtacctccaggcgtggcgggaccagggcgtcccggtcgactacgtcaccgcccag
aacgaacccacctgctgctccggctacccgtcgatgagctggaacggctcgggtctcgcc
tacttcaccaagagcgagctgctgccgaagctccggtcggcgggcctggccaccaaggtg
ctggcgcacgactggaactgggacagctacgacgcctacgccgcccccaccgtcgacgac
ccggccgtgcgcgaccacccgaacttcggcggggtcgcctggcacggctacggcggtgac
gtcgcgaagcagacggccgtccacgaccggtacccgcagctggacgccttccagaccgag
cactcgggcggcacctggatcgccgaccagcagcgcgaggacatgctgaacatcatcgac
tacacccgcaactgggcgaagtcggtgaccaagtggtcgctcgccgtcgaccagaaccgc
ggcccccacaacggcggttgcggcacctgcgacgggctggtcaccgtgcacaacggggac
agcaggcacggccaggtcgactacacgatcgagtactacacgatgggccacctgacgaag
tacgtccgacccggcgccgcccgcatcgcgtcgacgggcagctccgccgtgcccaacgtg
gcatggcgcaaccccgacggctcgaaggccctcatcgcctacaacgggtcggcctccgcc
cagcaggtcaccgtcaactggggcgggcagaagttcacctactccctgccgggccgcacc
tcggcgacgttcacctggtcgggcacccagtcgggctcctccggcagcaccggcgccctc
accgggaacggcggcaagtgcctcgacgccacgggccacagcggctcggacggcacaccg
gtgcagatctgggactgcaccggcgcggccaaccagaagtggacggtgtccggcgacggc
tcggtgaaggtgctcggcgcctgcctggacgtgacgtcgggctcgacggcggacggagcg
aaggtccagctgtacacctgcaacgggtcgggcgcgcaacgctggacgtacgactcctcg
acgggggacctcgtcaacacggccgcggacaagtgcctggacgtggccgaccggtccacc
gccgacggggcccgtgtccagatatggacgtgcaccggggcggccaaccagaagtggcgg
ctgcggtaa

DBGET integrated database retrieval system