KEGG   Streptomyces pratensis: Sfla_1896Help
Entry
Sfla_1896         CDS       T01647                                 

Definition
1,4-alpha-glucan-branching protein
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
sfa  Streptomyces pratensis
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sfa00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Sfla_1896
Enzymes [BR:sfa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     Sfla_1896
Exosome [BR:sfa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Sfla_1896
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2312922..2315495
Genome map
AA seq 857 aa AA seqDB search
MTSSSRLSPRALRAFRPPPSRVPRPFRVPESPEAPESPESPESSEEAVPVTARKPSRKSS
EPIEVPPTPEPVTTEVTAPAAAPAAAPATAPAGTQAPAESAPPPPVKRTRAKRTTTASGA
PPRPRRGGGSRNVLPATALDDTDRGRLLAGEHHDPHGVLGAHPTSGGVLFRALRPYARSV
TVLAGGKRAELQSDGDGFFSGVLALPAVPDGYRLKVAYDDATIEVDDPYRFLPAIGELDL
HLIGEGRHEELWKALGAQPMEHQGVAGTRFTVWAPNARGVRVTGDFNYWDGTAFPMRSLG
STGVWELFVPGVGEGAVYKYDICRPDGSHTQRADPMARHTEVPPATASVVTASHHTWQDA
DWMAHRGDRPVHEAPFSVYEIHLPSWRPGLTYRQLAAQLPSYVRELGFTHVELMPVSEHP
FGGSWGYQVTGFFAPTSRMGTPDDFRFLVDALHGAGIGVLMDWVPAHFPRDDWALAEFDG
RPLYEHSDPNRAAHPDWGTLEFDYGRKEVRNFLVSNATYWCEEFHIDGLRVDAVASMLYL
DYSREDGQWSPNEFGGRENLDAVAFLQEMNATVYRRNPGVVTMAEESTAWDGVTRATDHG
GLGFGLKWNMGWMHDSLVYMSKEPVHRKYHHDEMTFSMVYAYSENYVLPISHDEVVHGKQ
ALVSKMPGDWWQRRANHRAYLGYMWAHPGKQLLFMGQEFAQGAEWSEGHGPDWWLLDETY
EASADHRGVRTLVTDLNAVYNALPALWQRDTSPEGFSWIDGGAAEDNAFSFVRYDADGSP
LIAVSHFSPVVRNDYRIGVPDGPEAWVEVLNTDAGRYGGGDVRNEEPLKPEAVAAHGRDT
SITLTLPPLATVWLRPA
NT seq 2574 nt NT seq  +upstreamnt  +downstreamnt
gtgacctcctcctcccgcctctccccccgagcccttcgagccttccggcccccgccgtcg
cgggtcccccggcccttccgagtgcccgagtcccccgaagcccccgagtcccccgagtcc
cccgagtcttccgaggaggcagtccccgtgaccgcccgcaagccgtcccgcaaatcgtcc
gagcccatcgaggtcccgcccacgcccgagccggtgaccaccgaggtcaccgccccggcc
gcggcccccgcagccgctccggccaccgcgcccgccggtacgcaggcgccggccgagtcc
gcaccgccgccccccgtcaagcgcacgcgggccaagcggacgaccacggcgtccggcgcc
ccgccccgtccgcgccgaggcgggggcagcaggaacgtgctgcccgccaccgccctggac
gacacggaccggggccgtctgctcgccggcgagcaccacgacccgcacggagtcctgggc
gcgcacccgacctcgggcggagtactcttccgggcgctgcgcccctacgcacgctcggtg
accgtgttggccgggggcaagcgggccgagctgcagagcgacggcgacggcttcttctcc
ggcgtcctggcgctgcccgccgtgcccgacgggtaccgcctgaaggtcgcctacgacgac
gccacgatcgaggtggacgacccgtaccgcttcctgcccgccatcggcgaactcgacctg
cacctcatcggcgagggcaggcacgaggagctctggaaggcgctcggggcacagccgatg
gagcaccagggcgtggccggcacccggttcacggtctgggcgccgaacgcgcggggtgtc
cgcgtcacgggcgacttcaactactgggacggcacggccttccccatgcgctccctcggc
tccaccggggtgtgggagctcttcgtccccggtgtcggcgagggcgccgtgtacaagtac
gacatctgccggcccgacggatcgcacacccagcgtgccgacccgatggcccggcacacc
gaggtgccgcccgcgaccgcctcggtggtcaccgcctcgcaccacacgtggcaggacgcg
gactggatggcgcaccggggcgaccgcccggtgcacgaggcccccttctccgtctacgag
atccacctcccctcctggcgtccgggcctcacctaccggcagctggccgcccagctcccc
tcctacgtgcgggagctcggcttcacccatgtggagctgatgccggtctcggagcacccc
ttcggcggctcctggggctaccaggtcaccggcttcttcgcgccgacgtcccgtatgggc
acacccgacgacttccgcttcctggtcgacgcgctgcacggggcgggcatcggcgtcctc
atggactgggtgcccgcgcacttcccgcgcgacgactgggcgctcgccgagttcgacggc
aggccgctgtacgagcactccgacccgaacagggccgcgcacccggactggggcaccctg
gagttcgactacggccgcaaggaggtgcgcaacttcctcgtctccaacgccacgtactgg
tgcgaggagttccacatcgacgggctgcgggtcgacgcggtcgcctccatgctctacctc
gactactcccgtgaggacgggcagtggtcgccgaacgagttcgggggacgggagaacctg
gacgcggtcgccttcctccaggagatgaacgcgacggtctaccggcgcaaccccggtgtc
gtcacgatggcggaggagtcgaccgcctgggacggcgtcacccgcgcgacggaccacggc
gggctgggcttcggcctgaagtggaacatgggctggatgcacgactcgctggtctacatg
tccaaggagcccgtccaccggaagtaccaccacgacgagatgaccttctcaatggtgtac
gcgtacagcgagaactacgtgctgccgatctcccacgacgaggtggtgcacggcaagcag
gcgctggtcagcaagatgcccggcgactggtggcagcggcgggcgaaccaccgggcgtac
ctcggctacatgtgggcccaccccggtaagcaactcctcttcatgggccaggagttcgcc
cagggcgccgagtggtccgaggggcacggcccggactggtggctgctcgacgagacgtac
gaggcctccgccgaccaccggggcgtacgcaccctggtgacggacctcaacgcggtgtac
aacgcgctgcccgcgctctggcagcgggacacgtcgccggagggcttcagctggatcgac
gggggcgccgcggaggacaacgcgttctcgttcgtccggtacgacgcggacgggtccccg
ctgatcgccgtctcgcacttctccccggtggtacgcaacgactaccgcatcggtgtcccc
gacgggcccgaggcctgggtggaggtcctgaacacggacgcggggcgctacggcggaggc
gacgtacgcaacgaggagccgctgaagccggaggcggtggcggcccacggcagggacacc
agcatcacgctgacgctcccgccgctggcgacggtctggctgcggccggcctga

DBGET integrated database retrieval system