KEGG   Streptomyces pratensis: Sfla_1905Help
Entry
Sfla_1905         CDS       T01647                                 

Definition
phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
sfa  Streptomyces pratensis
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:sfa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Sfla_1905
   01230 Biosynthesis of amino acids
    Sfla_1905
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Sfla_1905
   00030 Pentose phosphate pathway
    Sfla_1905
   00051 Fructose and mannose metabolism
    Sfla_1905
   00052 Galactose metabolism
    Sfla_1905
  Energy metabolism
   00680 Methane metabolism
    Sfla_1905
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    Sfla_1905
Enzymes [BR:sfa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Sfla_1905
Protein phosphatases and associated proteins [BR:sfa01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Sfla_1905
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2324163..2325188)
Genome map
AA seq 341 aa AA seqDB search
MRIGILTAGGDCPGLNAVIRSVVHRAVVGHGDEVIGFEDGFKGLLDGHFRPLDLNAVSGI
LARGGTILGSARLERDRLREAAEHCAELSTRYGIDALIPIGGEGTLTAARMLSDAGMPVV
GVPKTIDNDISATDRTFGFDTAVGVATEAIDRLKTTAESHQRVMVVEVMGRHAGWIALES
GMAGGAHGICLPERPFQVDDLVKMVEERFARGKKFAVVCVAEGAHPAEGSMPYAKGEIDQ
FGHERFQGIGNRLAAELELRLGKEARPVILGHVQRGGTPTAYDRVLATRFGWNAVEAVHR
GDFGRMTALRGTEIVMAPLADAVTRLKTVPSDRMYEAESVF
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgcgcatcggaattctcaccgcaggcggcgactgccccggcctgaacgctgtgatccgg
tcggtcgtgcaccgggccgtggtgggccacggcgacgaggtcatcggcttcgaggacggc
ttcaaggggctgctcgacggccacttccggcccctcgacctgaacgctgtcagcggcatc
ctggcccgcggcggcacgatcctcggctcggcgcggctggagcgtgaccggctgcgcgag
gccgccgagcactgcgcggaactctccacccgctacggcatcgacgccctgatcccgatc
ggcggcgagggcacgctcaccgcggcccgcatgctgtccgacgcggggatgccggtcgtc
ggcgtcccgaagaccatcgacaacgacatctccgccaccgaccggaccttcggcttcgac
accgccgtgggcgtcgcgaccgaggccatagaccgcctcaagaccaccgccgagtcgcat
cagcgcgtcatggtcgtcgaggtcatgggccggcacgcgggctggatcgccctggagtcg
ggcatggccggcggcgcccacggcatctgccttccggagcgtccgttccaggtcgacgac
ctggtcaagatggtcgaggagcgtttcgcgcgcggcaagaagttcgccgtcgtctgcgtc
gcggagggagcccacccggccgagggctccatgccgtacgccaagggtgagatcgaccag
ttcgggcacgagcgcttccagggcatcggcaaccgcctcgccgccgaactggagctgcgc
ctcggcaaggaggcccggccggtcattctcggccatgtccagcgcggcggcaccccgacg
gcgtacgaccgtgtgctcgcgacccgcttcgggtggaacgccgtggaggccgtgcaccgc
ggtgacttcggccggatgacggcgctgcgcggcaccgagatcgtgatggccccgctggcc
gacgccgtgaccaggctgaagacggtccccagcgaccggatgtacgaggccgagtcggtc
ttctga

DBGET integrated database retrieval system