KEGG   Streptomyces pratensis: Sfla_1905Help
Entry
Sfla_1905         CDS       T01647                                 

Definition
(GenBank) phosphofructokinase
  KO
K21071  ATP-dependent phosphofructokinase / diphosphate-dependent phosphofructokinase [EC:2.7.1.11 2.7.1.90]
Organism
sfa  Streptomyces pratensis
Pathway
sfa00010  Glycolysis / Gluconeogenesis
sfa00030  Pentose phosphate pathway
sfa00051  Fructose and mannose metabolism
sfa00052  Galactose metabolism
sfa00680  Methane metabolism
sfa01100  Metabolic pathways
sfa01110  Biosynthesis of secondary metabolites
sfa01120  Microbial metabolism in diverse environments
sfa01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:sfa00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Sfla_1905
   00030 Pentose phosphate pathway
    Sfla_1905
   00051 Fructose and mannose metabolism
    Sfla_1905
   00052 Galactose metabolism
    Sfla_1905
  Energy metabolism
   00680 Methane metabolism
    Sfla_1905
Enzymes [BR:sfa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Sfla_1905
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     Sfla_1905
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase
Motif
Other DBs
NCBI-ProteinID: ADW03339
UniProt: E8WAP4
Position
complement(2324163..2325188)
Genome map
AA seq 341 aa AA seqDB search
MRIGILTAGGDCPGLNAVIRSVVHRAVVGHGDEVIGFEDGFKGLLDGHFRPLDLNAVSGI
LARGGTILGSARLERDRLREAAEHCAELSTRYGIDALIPIGGEGTLTAARMLSDAGMPVV
GVPKTIDNDISATDRTFGFDTAVGVATEAIDRLKTTAESHQRVMVVEVMGRHAGWIALES
GMAGGAHGICLPERPFQVDDLVKMVEERFARGKKFAVVCVAEGAHPAEGSMPYAKGEIDQ
FGHERFQGIGNRLAAELELRLGKEARPVILGHVQRGGTPTAYDRVLATRFGWNAVEAVHR
GDFGRMTALRGTEIVMAPLADAVTRLKTVPSDRMYEAESVF
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgcgcatcggaattctcaccgcaggcggcgactgccccggcctgaacgctgtgatccgg
tcggtcgtgcaccgggccgtggtgggccacggcgacgaggtcatcggcttcgaggacggc
ttcaaggggctgctcgacggccacttccggcccctcgacctgaacgctgtcagcggcatc
ctggcccgcggcggcacgatcctcggctcggcgcggctggagcgtgaccggctgcgcgag
gccgccgagcactgcgcggaactctccacccgctacggcatcgacgccctgatcccgatc
ggcggcgagggcacgctcaccgcggcccgcatgctgtccgacgcggggatgccggtcgtc
ggcgtcccgaagaccatcgacaacgacatctccgccaccgaccggaccttcggcttcgac
accgccgtgggcgtcgcgaccgaggccatagaccgcctcaagaccaccgccgagtcgcat
cagcgcgtcatggtcgtcgaggtcatgggccggcacgcgggctggatcgccctggagtcg
ggcatggccggcggcgcccacggcatctgccttccggagcgtccgttccaggtcgacgac
ctggtcaagatggtcgaggagcgtttcgcgcgcggcaagaagttcgccgtcgtctgcgtc
gcggagggagcccacccggccgagggctccatgccgtacgccaagggtgagatcgaccag
ttcgggcacgagcgcttccagggcatcggcaaccgcctcgccgccgaactggagctgcgc
ctcggcaaggaggcccggccggtcattctcggccatgtccagcgcggcggcaccccgacg
gcgtacgaccgtgtgctcgcgacccgcttcgggtggaacgccgtggaggccgtgcaccgc
ggtgacttcggccggatgacggcgctgcgcggcaccgagatcgtgatggccccgctggcc
gacgccgtgaccaggctgaagacggtccccagcgaccggatgtacgaggccgagtcggtc
ttctga

DBGET integrated database retrieval system