KEGG   Streptomyces flavogriseus: Sfla_2155Help
Entry
Sfla_2155         CDS       T01647                                 

Definition
dihydropteroate synthase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
sfa  Streptomyces flavogriseus
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:sfa00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2597903..2598775
Genome map
AA seq 290 aa AA seqDB search
MRSGTLRLGRREFGPHEPVIMAIVNRTPDSFYDQGATFRDEPALSRVEQAVAEGAAIIDI
GGVKAGPGEEVTAQEEARRTVGFVAEVRRRHPDVVISVDTWRHDVGAAVCEAGADVLNDA
WGGVDPKLAEVAARYGAGLVCTHAGGAEPRTRPHRIAYDDVVADILRVTLGLAERAVELG
VRPDGIMIDPGHDFGKNTRHSLEATRRLDEMTATGWPVLVSLSNKDFVGETLDRPVKERV
IGTLATTAVSAWLGAQVYRVHEVAETRQVLDMVASIAGHRPPAVARRGLA
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atgcgaagcgggacgctcaggctggggcggcgggagttcgggccgcacgagccggtgatc
atggcgatcgtgaaccggactcccgattccttctacgaccagggggcgacgttccgtgac
gagcccgcgctctccagggtcgagcaggccgtcgcggaaggtgccgcgatcatcgacatc
ggcggggtgaaggccggcccgggcgaggaggtgaccgcgcaggaggaggcccgtcgcacg
gtgggcttcgtcgccgaggtacggcgccgccacccggacgtcgtgatcagtgtggacacc
tggcggcacgacgtcggtgcggccgtctgcgaggcgggtgccgacgtgctgaacgacgcg
tggggcggcgtcgacccgaagctcgcggaggtggcggcgcggtacggcgccgggctcgtg
tgcacgcacgcgggcggcgcggagccccgcacccggccgcaccggatcgcgtacgacgac
gtggtggccgacatcctgcgggtcaccctggggctcgcggagcgggccgtggagctcggg
gtgaggccggacgggatcatgatcgatccgggccacgacttcggcaagaacacccgccac
tcgctggaggcgacccgccggctggacgagatgacggccaccggctggccggtgctggtc
tccctctccaacaaggacttcgtcggggagacgctcgacaggccggtcaaggagcgcgtg
atcggcacgctggccacgacggccgtctccgcgtggctgggggcgcaggtctaccgggtg
cacgaggtggccgagacccgtcaggtcctggacatggtcgcgtccatcgcgggccaccgg
ccgccggccgtcgcgcggcggggcctggcgtag

DBGET integrated database retrieval system