KEGG   Streptomyces pratensis: Sfla_2155Help
Entry
Sfla_2155         CDS       T01647                                 

Definition
dihydropteroate synthase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
sfa  Streptomyces pratensis
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sfa00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Sfla_2155
Enzymes [BR:sfa01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     Sfla_2155
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2597903..2598775
Genome map
AA seq 290 aa AA seqDB search
MRSGTLRLGRREFGPHEPVIMAIVNRTPDSFYDQGATFRDEPALSRVEQAVAEGAAIIDI
GGVKAGPGEEVTAQEEARRTVGFVAEVRRRHPDVVISVDTWRHDVGAAVCEAGADVLNDA
WGGVDPKLAEVAARYGAGLVCTHAGGAEPRTRPHRIAYDDVVADILRVTLGLAERAVELG
VRPDGIMIDPGHDFGKNTRHSLEATRRLDEMTATGWPVLVSLSNKDFVGETLDRPVKERV
IGTLATTAVSAWLGAQVYRVHEVAETRQVLDMVASIAGHRPPAVARRGLA
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atgcgaagcgggacgctcaggctggggcggcgggagttcgggccgcacgagccggtgatc
atggcgatcgtgaaccggactcccgattccttctacgaccagggggcgacgttccgtgac
gagcccgcgctctccagggtcgagcaggccgtcgcggaaggtgccgcgatcatcgacatc
ggcggggtgaaggccggcccgggcgaggaggtgaccgcgcaggaggaggcccgtcgcacg
gtgggcttcgtcgccgaggtacggcgccgccacccggacgtcgtgatcagtgtggacacc
tggcggcacgacgtcggtgcggccgtctgcgaggcgggtgccgacgtgctgaacgacgcg
tggggcggcgtcgacccgaagctcgcggaggtggcggcgcggtacggcgccgggctcgtg
tgcacgcacgcgggcggcgcggagccccgcacccggccgcaccggatcgcgtacgacgac
gtggtggccgacatcctgcgggtcaccctggggctcgcggagcgggccgtggagctcggg
gtgaggccggacgggatcatgatcgatccgggccacgacttcggcaagaacacccgccac
tcgctggaggcgacccgccggctggacgagatgacggccaccggctggccggtgctggtc
tccctctccaacaaggacttcgtcggggagacgctcgacaggccggtcaaggagcgcgtg
atcggcacgctggccacgacggccgtctccgcgtggctgggggcgcaggtctaccgggtg
cacgaggtggccgagacccgtcaggtcctggacatggtcgcgtccatcgcgggccaccgg
ccgccggccgtcgcgcggcggggcctggcgtag

DBGET integrated database retrieval system