KEGG   Streptomyces flavogriseus: Sfla_2202Help
Entry
Sfla_2202         CDS       T01647                                 

Definition
pyridoxal-5'-phosphate-dependent protein subunit beta
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
sfa  Streptomyces flavogriseus
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:sfa01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:sfa00260]
Metabolism; Metabolism of cofactors and vitamins; Vitamin B6 metabolism [PATH:sfa00750]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2654836..2655960
Genome map
AA seq 374 aa AA seqDB search
MSDSSLPTAAYFCPLDGSRAGITAPGWCCPVCKGPWDLDTGATRPVGLGSLSGRVNSLWR
YEEALPLSGPAVSLGEGRTPLVPLTERVSAKLDFLMPTLSFKDRGAVMLAELARRLSPER
VVADSSGNAGTAVAAYCARAGLPCTVYVPEGTSPKKTEQIRAHGARLVTVPGGREATASA
ARAAADTPGTFYASHVFNPFFLHGTKTYVYEIWEDLGGTLPDAIAVPVGNGTLLLGAALA
TSELLAHGLIDRRPALIAVQAEAVSPLAAAFRAGDDELSAAPAPARSTLAEGIAIPRPPR
ARQILAAVRESGGTFLTVTEDQIRSAQRDLAARGFFVETTGVACWAAVGAETDRSVVVPL
CGAGLKTGLAPGAP
NT seq 1125 nt NT seq  +upstreamnt  +downstreamnt
atgagcgactcctcgctgcccacggcggcctacttctgcccgctggacgggtcgcgggcc
ggcatcaccgcaccaggctggtgctgcccggtctgcaaaggcccctgggacctcgacaca
ggtgccacgcgaccggtcggcctcggctccctgagcggtcgggtcaactcgctgtggcgc
tacgaggaggctctcccgctctccggccccgccgtctccctgggcgagggcaggaccccg
ctcgtccccctcaccgagcgggtgtcggccaagctcgacttcctgatgcccacgctctcc
ttcaaggaccggggcgcggtgatgctggccgaactcgcccgcaggctctccccggagcgg
gtcgtcgcggacagcagcggcaacgcggggacggcggtcgccgcgtactgcgcccgggcc
gggctgccgtgcacggtctacgtccccgaggggacctcccccaagaagacggagcagatc
cgcgcccacggcgcccggctggtgacggtgcccggcggccgcgaggccacggcgtcggcc
gcccgggcggcggcggacacgcccggcaccttctacgcctcgcacgtcttcaacccgttc
ttcctgcacggcacgaagacgtacgtctacgagatctgggaggacctgggcggcaccctc
cccgacgccatcgccgtaccggtcggcaacggcacactgctcctgggcgcggccctcgcc
acctcggagctcctcgcgcacggcctgatcgaccggcgcccggccctgatcgccgtccag
gcggaggccgtctcgccgctggccgccgcgttccgggcgggtgacgacgagctgtccgcc
gcccccgcgccggcccggtccacgcttgccgaggggatcgccatcccccggccaccgcgc
gcccggcagatcctcgccgccgtccgggagtcgggcggcaccttcctgacggtgacggag
gaccagatccgttcggcacaacgggacctggccgcccgcggcttcttcgtcgagacgacg
ggggtcgcctgctgggccgccgtgggtgcggagacggaccggagcgtggtcgtcccgctc
tgcggggccggcctcaagacgggcctcgcgcccggggcaccgtga

DBGET integrated database retrieval system