KEGG   Streptomyces pratensis: Sfla_2202Help
Entry
Sfla_2202         CDS       T01647                                 

Definition
(RefSeq) pyridoxal-5'-phosphate-dependent protein subunit beta
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
sfa  Streptomyces pratensis
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:sfa00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Sfla_2202
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Sfla_2202
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Sfla_2202
Enzymes [BR:sfa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Sfla_2202
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2654836..2655960
Genome map
AA seq 374 aa AA seqDB search
MSDSSLPTAAYFCPLDGSRAGITAPGWCCPVCKGPWDLDTGATRPVGLGSLSGRVNSLWR
YEEALPLSGPAVSLGEGRTPLVPLTERVSAKLDFLMPTLSFKDRGAVMLAELARRLSPER
VVADSSGNAGTAVAAYCARAGLPCTVYVPEGTSPKKTEQIRAHGARLVTVPGGREATASA
ARAAADTPGTFYASHVFNPFFLHGTKTYVYEIWEDLGGTLPDAIAVPVGNGTLLLGAALA
TSELLAHGLIDRRPALIAVQAEAVSPLAAAFRAGDDELSAAPAPARSTLAEGIAIPRPPR
ARQILAAVRESGGTFLTVTEDQIRSAQRDLAARGFFVETTGVACWAAVGAETDRSVVVPL
CGAGLKTGLAPGAP
NT seq 1125 nt NT seq  +upstreamnt  +downstreamnt
atgagcgactcctcgctgcccacggcggcctacttctgcccgctggacgggtcgcgggcc
ggcatcaccgcaccaggctggtgctgcccggtctgcaaaggcccctgggacctcgacaca
ggtgccacgcgaccggtcggcctcggctccctgagcggtcgggtcaactcgctgtggcgc
tacgaggaggctctcccgctctccggccccgccgtctccctgggcgagggcaggaccccg
ctcgtccccctcaccgagcgggtgtcggccaagctcgacttcctgatgcccacgctctcc
ttcaaggaccggggcgcggtgatgctggccgaactcgcccgcaggctctccccggagcgg
gtcgtcgcggacagcagcggcaacgcggggacggcggtcgccgcgtactgcgcccgggcc
gggctgccgtgcacggtctacgtccccgaggggacctcccccaagaagacggagcagatc
cgcgcccacggcgcccggctggtgacggtgcccggcggccgcgaggccacggcgtcggcc
gcccgggcggcggcggacacgcccggcaccttctacgcctcgcacgtcttcaacccgttc
ttcctgcacggcacgaagacgtacgtctacgagatctgggaggacctgggcggcaccctc
cccgacgccatcgccgtaccggtcggcaacggcacactgctcctgggcgcggccctcgcc
acctcggagctcctcgcgcacggcctgatcgaccggcgcccggccctgatcgccgtccag
gcggaggccgtctcgccgctggccgccgcgttccgggcgggtgacgacgagctgtccgcc
gcccccgcgccggcccggtccacgcttgccgaggggatcgccatcccccggccaccgcgc
gcccggcagatcctcgccgccgtccgggagtcgggcggcaccttcctgacggtgacggag
gaccagatccgttcggcacaacgggacctggccgcccgcggcttcttcgtcgagacgacg
ggggtcgcctgctgggccgccgtgggtgcggagacggaccggagcgtggtcgtcccgctc
tgcggggccggcctcaagacgggcctcgcgcccggggcaccgtga

DBGET integrated database retrieval system