KEGG   Streptomyces pratensis: Sfla_2202Help
Entry
Sfla_2202         CDS       T01647                                 

Definition
pyridoxal-5'-phosphate-dependent protein subunit beta
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
sfa  Streptomyces pratensis
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:sfa00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Sfla_2202
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Sfla_2202
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Sfla_2202
Enzymes [BR:sfa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Sfla_2202
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2654836..2655960
Genome map
AA seq 374 aa AA seqDB search
MSDSSLPTAAYFCPLDGSRAGITAPGWCCPVCKGPWDLDTGATRPVGLGSLSGRVNSLWR
YEEALPLSGPAVSLGEGRTPLVPLTERVSAKLDFLMPTLSFKDRGAVMLAELARRLSPER
VVADSSGNAGTAVAAYCARAGLPCTVYVPEGTSPKKTEQIRAHGARLVTVPGGREATASA
ARAAADTPGTFYASHVFNPFFLHGTKTYVYEIWEDLGGTLPDAIAVPVGNGTLLLGAALA
TSELLAHGLIDRRPALIAVQAEAVSPLAAAFRAGDDELSAAPAPARSTLAEGIAIPRPPR
ARQILAAVRESGGTFLTVTEDQIRSAQRDLAARGFFVETTGVACWAAVGAETDRSVVVPL
CGAGLKTGLAPGAP
NT seq 1125 nt NT seq  +upstreamnt  +downstreamnt
atgagcgactcctcgctgcccacggcggcctacttctgcccgctggacgggtcgcgggcc
ggcatcaccgcaccaggctggtgctgcccggtctgcaaaggcccctgggacctcgacaca
ggtgccacgcgaccggtcggcctcggctccctgagcggtcgggtcaactcgctgtggcgc
tacgaggaggctctcccgctctccggccccgccgtctccctgggcgagggcaggaccccg
ctcgtccccctcaccgagcgggtgtcggccaagctcgacttcctgatgcccacgctctcc
ttcaaggaccggggcgcggtgatgctggccgaactcgcccgcaggctctccccggagcgg
gtcgtcgcggacagcagcggcaacgcggggacggcggtcgccgcgtactgcgcccgggcc
gggctgccgtgcacggtctacgtccccgaggggacctcccccaagaagacggagcagatc
cgcgcccacggcgcccggctggtgacggtgcccggcggccgcgaggccacggcgtcggcc
gcccgggcggcggcggacacgcccggcaccttctacgcctcgcacgtcttcaacccgttc
ttcctgcacggcacgaagacgtacgtctacgagatctgggaggacctgggcggcaccctc
cccgacgccatcgccgtaccggtcggcaacggcacactgctcctgggcgcggccctcgcc
acctcggagctcctcgcgcacggcctgatcgaccggcgcccggccctgatcgccgtccag
gcggaggccgtctcgccgctggccgccgcgttccgggcgggtgacgacgagctgtccgcc
gcccccgcgccggcccggtccacgcttgccgaggggatcgccatcccccggccaccgcgc
gcccggcagatcctcgccgccgtccgggagtcgggcggcaccttcctgacggtgacggag
gaccagatccgttcggcacaacgggacctggccgcccgcggcttcttcgtcgagacgacg
ggggtcgcctgctgggccgccgtgggtgcggagacggaccggagcgtggtcgtcccgctc
tgcggggccggcctcaagacgggcctcgcgcccggggcaccgtga

DBGET integrated database retrieval system