KEGG   Streptomyces pratensis: Sfla_2214Help
Entry
Sfla_2214         CDS       T01647                                 

Definition
(GenBank) ROK family protein
  KO
K00886  polyphosphate glucokinase [EC:2.7.1.63]
Organism
sfa  Streptomyces pratensis
Pathway
sfa00010  Glycolysis / Gluconeogenesis
sfa00520  Amino sugar and nucleotide sugar metabolism
sfa01100  Metabolic pathways
sfa01110  Biosynthesis of secondary metabolites
sfa01120  Microbial metabolism in diverse environments
sfa01130  Biosynthesis of antibiotics
sfa01200  Carbon metabolism
Module
sfa_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:sfa00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Sfla_2214
   00520 Amino sugar and nucleotide sugar metabolism
    Sfla_2214
Enzymes [BR:sfa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.63  polyphosphate---glucose phosphotransferase
     Sfla_2214
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK
Motif
Other DBs
NCBI-ProteinID: ADW03645
UniProt: E8WEY2
Position
complement(2664733..2665455)
Genome map
AA seq 240 aa AA seqDB search
MDIGGSGIKGAPVDLDRGELAQERHKVLTPHPATPASVADGVAEVVGHFDWKGPVGITFP
GVVTGGITRTAANVDKGWIDTDARKLLSERIGQPVTILNDADAAGVAEMTFGAGRDRKGT
VIMLTLGTGIGSAVFTDGQLVPNTELGHLELHGHDAEKRASTKAKEDEDLSWHHWAHRVQ
KYLVHVEMLFSPELFIIGGGVSRKAEKFLPLIEHVRAEIVPAQLQNNAGIVGAAMAAAGR
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
gtggacatcggcggttcagggatcaagggcgcgcccgtggacctggaccgcggagagctg
gcgcaggagcgccacaaggtactgacaccccacccggccacgcccgcgagcgtggccgac
ggtgtggccgaggtcgtcggccatttcgactggaagggcccggtcggcatcacgttcccc
ggagtcgtcaccggcggcatcacccggaccgcggccaacgtggacaagggctggatcgac
acggacgcccggaagctgctcagcgagcgcatcgggcagccggtcacgatcctcaacgac
gccgacgccgccggtgtcgccgagatgaccttcggcgccggccgtgaccgcaagggcacc
gtgatcatgctgaccctcgggacgggcatcggcagcgcggtcttcaccgacgggcagctg
gtgcccaacacggagctcggtcatctggagctgcacggccacgacgcggagaagcgcgcc
tccacgaaggccaaggaggacgaggacctcagctggcaccactgggcgcaccgggtgcag
aagtacttggtccacgtggagatgctgttctcgcccgaactgttcatcatcggcggcggc
gtcagccgcaaggcggagaagttcctgccgctcatcgagcacgtacgcgccgagatcgtc
ccggcccagctccagaacaacgcgggcatcgtcggagcggccatggcggccgcgggccgg
tag

DBGET integrated database retrieval system