KEGG   Streptomyces pratensis: Sfla_2391Help
Entry
Sfla_2391         CDS       T01647                                 

Definition
succinate dehydrogenase cytochrome b subunit
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
sfa  Streptomyces pratensis
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:sfa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Sfla_2391
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Sfla_2391
   00650 Butanoate metabolism
    Sfla_2391
  Energy metabolism
   00190 Oxidative phosphorylation
    Sfla_2391
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2845892..2846371
Genome map
AA seq 159 aa AA seqDB search
MSTETPSSAIGDVEGVSLYDVDNPAPVIEPPRKRTGKTPKGSRTNFEMYAWLFMRLSGIV
LVVLVIGHLLIQLVLDGGVSKIGFAFVAGRWASPFWQVWDLAMLWLAMLHGANGLRTVIN
DYAERDNTRFWLKMLLYTATVFTVLLGTLVIFTFDPNIR
NT seq 480 nt NT seq  +upstreamnt  +downstreamnt
atgtccaccgagacaccttcttccgcgatcggtgacgtcgagggcgtaagcctctacgac
gtcgacaacccggccccggtcatcgagcccccgcgcaagcgcacgggcaagacccccaag
ggctcgcgcaccaacttcgagatgtacgcctggctcttcatgcgcctgtcgggcatcgtg
ctggtcgtcctggtcatcggtcacctgctgatccagctggtgctcgacggcggcgtgtcg
aagatcggcttcgccttcgtcgcgggccgctgggcctcgccgttctggcaggtctgggac
ctggcgatgctgtggctcgccatgctccacggcgccaacggcctccgtacggtcatcaac
gactacgccgaacgggacaacacccgcttctggctgaagatgctcctgtacaccgccacg
gtgttcaccgtcctgctgggcacgctggtgatcttcaccttcgacccgaacatccgctag

DBGET integrated database retrieval system