KEGG   Streptomyces flavogriseus: Sfla_2446Help
Entry
Sfla_2446         CDS       T01647                                 

Definition
GMC oxidoreductase
Orthology
K03333  
cholesterol oxidase [EC:1.1.3.6]
Organism
sfa  Streptomyces flavogriseus
Class
Metabolism; Xenobiotics biodegradation and metabolism; Steroid degradation
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2910137..2911975)
Genome map
AA seq 612 aa AA seqDB search
MSQDSHAQNQAGRAVPAADDDAYDYDVLVVGSGFGGAVSALRLSEKGYRVGVLEAGRRFT
PATLPKNSWDIKNYLWAPALGLFGIQRVHLLGKVMVLAGAGVGGGSLNYANTLYVPPAPF
FEDRQWAGITDWKAELAPYYDQAKRMLGVRLNPTVTPADVHLKAVAETMGVGDTFHLAPV
GVFFGDGEDADGTARAKPGGEVADPYFGGAGPTRKACSECGECMTGCRHGAKNTLNENYL
HLAERAGAVIHPMTSVVAVTDGPDAGYRVSTVPTNRRRKAAPTVLRARNVVVAAGTYGTQ
TLLHTMKDEGLLPRLSSRLGELTRTNSEGLVGAQTSDRRYRKKHGTGKADFTRGVAITSS
IHPDENTHIEPVRYGKGSNAMGALTILQVPYSTHRVLGWFGSVARHPVLTMRSLSNRRWS
ERTIIGLVMQSLDNSLTAYRKPGGVGKGLLTARQGHGSPNPTQIAEATQGATLLAQEING
FAGSNVGELMGTPLTAHFLGGCPIGASPEEGVIDPYHRLYGHPGISVVDGSAVSANLGVN
PSLTITAQAERAMSFWPNKGEADPRPAQDAAYERLAAVVPQAPAVPEDAFGALKLPFLGI
PVVPPKKAASDA
NT seq 1839 nt NT seq  +upstreamnt  +downstreamnt
atgtcccaggacagccatgcccagaaccaggccggccgggccgttccggccgcggacgac
gacgcgtacgactacgacgtcctcgtcgtcggctcgggcttcggcggcgcggtctcggcc
ctgcggctgagcgagaagggataccgggtcggcgtcctggaggcgggccgccgcttcacc
cccgcgaccctgcccaagaactcctgggacatcaagaactacctgtgggcccccgcactc
ggactgttcggcatccagcgggtgcacctgctcggcaaggtgatggtgctggccggcgcc
ggagtgggcggcggctccctcaactacgccaacaccctgtacgtgccaccggcgcccttc
ttcgaggaccgtcagtgggccggcatcaccgactggaaggccgaactggcgccctactac
gaccaggcgaagcggatgctcggggtgcggctcaacccgaccgtgaccccggcggacgtc
cacctcaaggccgtcgccgagacgatgggcgtcggtgacaccttccatctggccccggtg
ggcgtcttcttcggcgacggcgaggacgccgacgggaccgcgcgcgcgaagcccggagga
gaggtggccgacccctacttcggcggcgccggccccacgcgcaaggcctgctccgagtgc
ggtgaatgcatgacgggctgccgccacggggcgaagaacaccctcaacgagaactacctc
cacctggcggagagggccggtgccgtcatccacccgatgacgtccgtcgtcgcggtcacg
gacggcccggacgccggctaccgcgtgtcgaccgtgcccacgaaccggcggcgcaaggcc
gctccgaccgtgctgcgggccaggaacgtggtcgtcgccgcgggtacgtacggcacccag
accctgttgcacacgatgaaggacgaggggctgctgccccggctgtcgtcccggctcggc
gagctgacccggaccaactccgagggcctggtgggggcgcagaccagcgaccgccgctac
cgcaagaagcacggcaccggcaaggcggacttcacccggggtgtcgcgatcacctcgtcg
atccatccggacgagaacacccacatcgagccggtgcgttacggcaagggctccaacgcg
atgggcgcgctgaccatcctccaggtgccctacagcacccaccgggtgctgggctggttc
ggcagcgtcgccaggcacccggtgctcacgatgcgctcgctgtccaaccggcgctggtcg
gaacggacgatcatcggtctcgtgatgcagtcgctggacaactcgctgaccgcctaccgc
aagcccggcggcgtcggcaagggcctgctcaccgcccggcagggccacggctcgcccaac
ccgacgcagatagccgaggccacccagggcgccacgctgctcgcccaggagatcaacggc
ttcgccggatcgaacgtcggggagctgatgggcaccccgctcaccgcgcacttcctcggc
ggctgcccgatcggggcgagcccggaggagggcgtcatcgacccgtaccaccggctctac
gggcaccccggcatctcggtggtcgacggttccgcggtctccgccaacctcggggtgaac
ccgtcgctgaccatcaccgcgcaggcggagcgggcgatgtccttctggcccaacaagggc
gaggcggacccgcgccccgcacaggacgcggcgtacgaacggctcgccgcggtcgtaccg
caggcgcccgcggtgcccgaggacgccttcggcgcgctgaagctgccgttcctgggcatt
ccggtggtgccgccgaagaaggcggcgtcggacgcctga

DBGET integrated database retrieval system