KEGG   Streptomyces pratensis: Sfla_2794Help
Entry
Sfla_2794         CDS       T01647                                 

Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
sfa  Streptomyces pratensis
Pathway
sfa00260  Glycine, serine and threonine metabolism
sfa00750  Vitamin B6 metabolism
sfa01100  Metabolic pathways
sfa01110  Biosynthesis of secondary metabolites
sfa01120  Microbial metabolism in diverse environments
sfa01230  Biosynthesis of amino acids
Module
sfa_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:sfa00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Sfla_2794
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Sfla_2794
Enzymes [BR:sfa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Sfla_2794
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: ADW04222
UniProt: E8W6H3
Position
complement(3263956..3265254)
Genome map
AA seq 432 aa AA seqDB search
MAVQTVAENTNSSAVDLGPAAALSCRECGERFELGPIFACVSCFGPLEVAYDLPSGSPEE
LKKRIAEGPDNIWRYAPLLPVPSDVADKPNINPGFTKLVKADNLARELGVTGGLYVKDDS
GNPTHSFKDRVVAIAVEAARAFGFTTLSCSSTGNLAGAVGAAAARAGFRSCVFIPHDLEQ
GKVVMAAVYGGELVGIEGNYDDVNRFCSELIGDPLGEGWGFVNVNLRPYYGEGSKTLAYE
ICEQLGWQLPDQLVIPIASGSQLTKIDKGLQELIKLGLVEDKPYKIFGAQAEGCSPVSTA
FKAGHDVVRPQKPNTIAKSLAIGNPADGPYVLDIARRTGGAVEDVNDEQVVDAIKLLART
EGIFAETAGGVTVGVTKKLIEAGLLDPSLTTVVLNTGDGLKTLDAVAPTTGLSATIRPSL
DAFRDAGLAAAN
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
atggccgtgcagacagttgcagagaacaccaattcttccgccgtggacctcggtcccgcc
gccgcgctttcctgtcgcgaatgcggcgagcgtttcgagctcggccccatcttcgcctgc
gtgtcctgtttcgggccgctcgaagtggcgtacgacctgccgagcggctcccccgaagag
ctgaagaagcgcatcgccgagggtccggacaacatctggcggtacgcgccgctgctgccc
gtcccctccgacgtcgcggacaagcccaacatcaaccccggcttcacgaagctggtcaag
gccgacaacctcgcccgcgagctcggcgtgaccggcggactgtacgtcaaggacgactcc
ggcaacccgacgcactccttcaaggaccgtgtcgtcgccatcgccgtcgaggcggcccgc
gccttcgggttcaccaccctctcctgctcctccaccggcaacctggccggtgcggtgggt
gccgccgccgcccgcgccggcttccgctcctgcgtgttcatcccgcacgacctggagcag
ggcaaggtcgtcatggccgcggtgtacggcggtgagctcgtcggtatcgagggcaactac
gacgacgtcaaccgcttctgctcggagctcatcggcgacccgctcggcgagggctggggc
ttcgtcaacgtcaacctgcggccgtactacggcgagggctccaagaccctggcgtacgag
atctgcgagcagctgggctggcagctgcccgaccagctcgtcatccccatcgcgtccggc
tcacagctcacgaagatcgacaagggtctccaggagctgatcaagctcggtctcgtcgag
gacaagccgtacaagatcttcggcgcccaggccgagggctgctccccggtctccaccgcc
ttcaaggccggccacgacgtggtccgcccgcagaagccgaacaccatcgccaagtccctg
gcgatcggcaacccggccgacggcccgtacgtcctggacatcgcccgccgcaccggcggt
gccgtggaggacgtgaacgacgagcaggtcgtcgacgcgatcaagctgctggcccgcacc
gaggggatcttcgcggagaccgcgggcggggtgacggtcggcgtgacgaagaagctgatc
gaggccggtctgctcgacccgtccctgaccaccgtcgtcctgaacaccggcgacggcctg
aagacgctggacgcggtcgccccgacgaccggcctgtcggccacgatccggcccagcctg
gacgcgttccgcgacgcgggcctcgctgccgccaactga

DBGET integrated database retrieval system