KEGG   Streptomyces pratensis: Sfla_2840Help
Entry
Sfla_2840         CDS       T01647                                 

Definition
(RefSeq) phosphoglycerate mutase
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
sfa  Streptomyces pratensis
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:sfa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Sfla_2840
   01230 Biosynthesis of amino acids
    Sfla_2840
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Sfla_2840
  Energy metabolism
   00680 Methane metabolism
    Sfla_2840
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Sfla_2840
Enzymes [BR:sfa01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Sfla_2840
Exosome [BR:sfa04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Sfla_2840
  Exosomal proteins of melanoma cells
   Sfla_2840
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3313547..3314308
Genome map
AA seq 253 aa AA seqDB search
MADAPYKLILLRHGESEWNAKNLFTGWVDVDLTDKGEKEAVRGGELLKDAGLLPDVVHTS
LQKRAIRTAQLGLEAADRHWIPVHRSWRLNERHYGALQGKDKAQTLAEFGEEQFMLWRRS
YDTPPPALEDGTEFSQSADPRYATIPPELRPRTECLKDVVIRMLPYWYDGIVPDLLDGKT
VLVAAHGNSLRGLVKHLDGISDDAISGLNIPTGIPLAYELDADFRPLKPGGTYLDPDAAK
AAIEAVKNQGKKK
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atggccgacgcaccgtacaagctgatcctcctccgccacggcgagagcgaatggaacgcg
aagaacctgttcaccggatgggtggacgtagacctcacggacaagggcgagaaggaggcg
gtccgcggcggtgagctgctcaaggacgccggcctgctccccgacgtcgtacacacctcg
ctccagaagcgcgcgatccgcaccgcccagctcgggctggaggccgccgaccgccactgg
atccccgtgcaccgctcctggcgcctgaacgagcgccactacggcgcgctccagggcaag
gacaaggcccagacgctcgccgagttcggcgaggagcagttcatgctctggcgccgctcg
tacgacaccccgccgccggcgctcgaggacggcaccgagttctcgcagagcgccgacccg
cgctacgcgacgatcccgccggagctgcgcccgcgcacggagtgcctcaaggacgtcgtc
atccgcatgctgccgtactggtacgacggcatcgtcccggacctcctcgacggcaagacc
gtcctggtcgccgcccatggcaacagcctgcgcggcctggtgaagcacctggacggcatc
tccgacgacgccatctcgggcctcaacatcccgaccggcatcccgctcgcctacgagctg
gacgccgacttccgccccctgaagccgggcggcacgtacctggacccggacgcggcgaag
gctgcgatcgaggccgtgaagaaccagggcaagaagaagtaa

DBGET integrated database retrieval system