KEGG   Streptomyces pratensis: Sfla_3227Help
Entry
Sfla_3227         CDS       T01647                                 

Definition
(GenBank) catalytic domain-containing protein of components of various dehydrogenase complexes
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
sfa  Streptomyces pratensis
Pathway
sfa00010  Glycolysis / Gluconeogenesis
sfa00020  Citrate cycle (TCA cycle)
sfa00620  Pyruvate metabolism
sfa01100  Metabolic pathways
sfa01110  Biosynthesis of secondary metabolites
sfa01120  Microbial metabolism in diverse environments
sfa01130  Biosynthesis of antibiotics
sfa01200  Carbon metabolism
Module
sfa_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:sfa00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Sfla_3227
   00020 Citrate cycle (TCA cycle)
    Sfla_3227
   00620 Pyruvate metabolism
    Sfla_3227
Enzymes [BR:sfa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Sfla_3227
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding GCV_H
Motif
Other DBs
NCBI-ProteinID: ADW04648
UniProt: E8WCY1
Position
3736039..3737454
Genome map
AA seq 471 aa AA seqDB search
MAQVLEFKLPDLGEGLTEAEIVRWLVEVGDVVAVDQPVVEVETAKAMVEVPCPYGGVVTA
RYGEEGTELPVGAPLLTVAVGSVEPVAGRDDSGGSTGGGAAESGTSGNVLVGYGTGAPVA
RRRRVRPTPVSAESSVPATGIKASARADAETYMAAGPTVAAAVASAPTSGVVEPQGPVAV
ISPLVRKLARQHGLDLRQIVGTGRDGLILRTDVESAVRAADEESAAGTEPVTAPKAEPSV
ERIPLRGVRGAVADKLSRSRREIPDATCWVDADATELMAARAAMNAAGGSAAGPKVSVLA
LLARICTAALARFPELNSTVDADAREIVRLAGVHLGFAAQTERGLVVPVVRDAHTRNAES
IGAEIARLTDAARDGKLTPAQLTGGTFTLNNYGVFGVDGSTPIINHPEAAMLGVGRIMPK
PWVHEGELAVRQVVQLSLTFDHRVCDGGTAGGFLRYVADCVEQPAVLLRTL
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
atggcacaggtactcgaattcaagcttcctgacctgggtgaaggactgaccgaggccgag
atcgtgcgctggctggtcgaggtcggcgacgtggtcgccgtcgaccaaccggtcgtcgag
gtcgagacggccaaagccatggtggaggttccctgcccgtacgggggtgtggtgacggcg
cgatacggcgaggagggcacggagctcccggtaggcgcaccactgttgaccgtggcggtc
ggatcggtggagccggtcgcggggcgcgatgactccggtgggtccaccggcggcggtgcc
gccgagagcgggacgtccgggaacgttctcgtcggctacggcacgggtgcaccggtcgcc
cggaggcgcagggtcaggcccaccccggtctcggccgagtcctcggtaccggctaccggg
atcaaggcatcggcccgggcggacgcggagacgtacatggccgcggggccgaccgtcgct
gcggcggtggcttcggccccgacatccggagtggtggagcctcaggggcccgttgcggtc
atctcccctctggtccggaagctggcgcggcagcacggtctcgatctccggcagatcgtc
ggcacggggcgtgacgggctgatcctgcgtacggacgtggagtccgccgtcagggccgcg
gacgaagagtctgccgccgggacagagcccgtgaccgcgccgaaggcggaaccctcggtc
gagcggatccctctgcgtggggtccggggcgcggtcgctgacaagctgtcacgcagtcgg
cgggagattcccgacgcgacgtgctgggtcgacgccgatgccaccgaactgatggcagcg
cgtgctgcgatgaacgcggccggcgggtccgcagcggggccgaaggtatccgtgctggcc
ctgctggcccgcatctgcacggcggccctggctcggttccctgagctcaactcgacggtg
gacgcggatgcgcgggagatcgtgcggctcgccggggtccatctggggtttgccgcgcag
acggagcggggcctggtcgttccggtcgtccgggacgcgcacacgaggaacgcggagtcg
atcggcgcggagatcgcccgcctgaccgacgcggcccgggacgggaagctgacccctgcg
cagctcaccggcgggacgttcacgctgaacaactacggggtcttcggggtcgacggctcg
actcccatcatcaaccaccccgaagcggccatgctcggggtcggccggatcatgcccaaa
ccctgggtgcacgagggtgagctggcggtccgccaggtcgtccagctctccctcaccttc
gaccaccgcgtctgcgacggcggcacggccggtgggttcctgaggtacgtggccgactgc
gttgaacaaccggcggtgctgctgcgcacactgtga

DBGET integrated database retrieval system