KEGG   Streptomyces flavogriseus: Sfla_3379Help
Entry
Sfla_3379         CDS       T01647                                 

Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
sfa  Streptomyces flavogriseus
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:sfa03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3900193..3900792
Genome map
AA seq 199 aa AA seqDB search
MYEGVVQELIDELGRLPGVGPKSAQRIAFHVLQAEPTDVRRLAHALLEVKDKVRFCEICG
NVAQQEQCGICRDARRDRSVICVVEEPKDVVAIERTREFRGRYHVLGGAISPIEGVGPDD
LRIRELLARLADGSITELILATDPNLEGEATATYLARMVKPMGLRVTRLASGLPVGGDLE
YADEVTLGRAFEGRRLLDV
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
ttgtacgaaggcgttgttcaggagctgatcgacgagctgggcaggctgccgggcgtcggt
cccaagagcgcgcagcggatcgccttccacgtcctgcaggccgagcccaccgacgtgcgc
cgtctggcccacgccctgctcgaggtcaaggacaaggtccggttctgcgagatctgcggc
aacgtcgcgcagcaggagcagtgcgggatctgccgtgacgcccgccgcgaccgctcggtg
atctgcgtggtcgaggagcccaaggacgtcgtcgcgatcgagcggacccgtgagttccgc
ggccgttaccacgtgctgggcggcgcgatcagcccgatcgagggcgtcggccccgacgac
ctgcgtatccgggagctgctggcccggctcgcggacggctccatcacggagctgatcctg
gcgacggaccccaacctggagggcgaggccaccgcgacgtacctcgcccggatggtcaag
ccgatgggcctgcgggtcacgcggctggccagcgggctgcccgtcggcggcgacctggag
tacgccgacgaggtcaccctcggccgcgccttcgagggaaggcggctgctcgatgtgtga

DBGET integrated database retrieval system