KEGG   Streptomyces pratensis: Sfla_3379Help
Entry
Sfla_3379         CDS       T01647                                 

Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
sfa  Streptomyces pratensis
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:sfa00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Sfla_3379
DNA repair and recombination proteins [BR:sfa03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Sfla_3379
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3900193..3900792
Genome map
AA seq 199 aa AA seqDB search
MYEGVVQELIDELGRLPGVGPKSAQRIAFHVLQAEPTDVRRLAHALLEVKDKVRFCEICG
NVAQQEQCGICRDARRDRSVICVVEEPKDVVAIERTREFRGRYHVLGGAISPIEGVGPDD
LRIRELLARLADGSITELILATDPNLEGEATATYLARMVKPMGLRVTRLASGLPVGGDLE
YADEVTLGRAFEGRRLLDV
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
ttgtacgaaggcgttgttcaggagctgatcgacgagctgggcaggctgccgggcgtcggt
cccaagagcgcgcagcggatcgccttccacgtcctgcaggccgagcccaccgacgtgcgc
cgtctggcccacgccctgctcgaggtcaaggacaaggtccggttctgcgagatctgcggc
aacgtcgcgcagcaggagcagtgcgggatctgccgtgacgcccgccgcgaccgctcggtg
atctgcgtggtcgaggagcccaaggacgtcgtcgcgatcgagcggacccgtgagttccgc
ggccgttaccacgtgctgggcggcgcgatcagcccgatcgagggcgtcggccccgacgac
ctgcgtatccgggagctgctggcccggctcgcggacggctccatcacggagctgatcctg
gcgacggaccccaacctggagggcgaggccaccgcgacgtacctcgcccggatggtcaag
ccgatgggcctgcgggtcacgcggctggccagcgggctgcccgtcggcggcgacctggag
tacgccgacgaggtcaccctcggccgcgccttcgagggaaggcggctgctcgatgtgtga

DBGET integrated database retrieval system